KEGG   Mus musculus (mouse): 233979Help
Entry
233979            CDS       T01002                                 

Gene name
Tpcn2, D830047E22Rik, Gm35086
Definition
(RefSeq) two pore segment channel 2
  KO
K14077  
two pore calcium channel protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    233979 (Tpcn2)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  CatSper and two-pore channel
   233979 (Tpcn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F5
AA seq 731 aa AA seqDB search
MAAEEQPLLGRDRGSGQVHSGAAADQELCIDQAVVFIEDAIKYRSIYHRMDAGSLWLYRW
YYSNVCQRVLGFIIFLILILAFVEVPSSFTKTADVRYRSQPWQPPCGLTETIEAFCLLAF
LVDLSVKGYLVGQAQLQQNLWLLAYFMVLVVSVVDWIVSLSLACEEPLRMRRLLRPFFLL
QNSSMMKKTLKCIRWSLPEMASVGLLLAIHLCLFTIIGMLLFTIGEKDEAQDQERLAYFR
NLPEALTSLLVLLTTSNNPDVMIPAYTQNRAFALFFIVFTLIGSLFLMNLLTAIIYNQFR
GYLMKSLQTSLFRRRLGARAAYEVLASRAGPAGTTPELVGVNPETFLPVLQKTQLNKTHK
QAIMQKVQSYEGRPMLADEFQKLFDEVDKGLAKERPLKPQYQSPFLQTAQFIFSHHYFDY
LGNLVALGNLLSICVFLVLDSDLLPGERDDFVLGILDYIFILYYLLELLFKVFALGLPGY
LSYHSNVFDGLLTIILLVSEICTLAVYRLPHSGWKPEQYGPLSLWDMTRLMNTLIVFRFL
RIIPNIKPMAEVANTILGLIPNLRAFGGILVVAYYVFAMIGINLFRGVIVPPGNSSLVPD
NNSAVCGSFEQLGYWPNNFDDFAAALITLWNVMVVNNWQVILEAYKRYAGPWSMVYFVLW
WLVSSVIWINLFLALLLENFLHRWDPQGHKQLLVGTKQMSVELMFRDILEEPKEEELMEK
LHKHPHLHLCR
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagaagagcagccccttctgggccgggaccgaggcagtggccaggtccactcc
ggtgctgcagccgatcaggagctctgcatagaccaggctgtggtcttcattgaagacgcc
ataaagtaccgctccatctaccaccgcatggatgctggttcattgtggctttaccgctgg
tattactcgaacgtctgccaacgtgtgctgggcttcatcattttcctgatcctgatcttg
gcttttgtggaggtcccatcttccttcacaaagactgcagatgtgcgctaccgttcccag
ccctggcagccgccctgtggcctgaccgagacgatcgaggcgttctgcttgcttgccttc
ctggttgacctctctgtgaagggctacttggttgggcaggcccagttgcagcagaacctg
tggctgctggcctactttatggtgctggttgtgtctgtggtggactggatcgtttcgctg
agccttgcttgtgaggagcccctgcggatgcgccggctgctccgccccttcttcctgctg
cagaattcctccatgatgaagaagaccctgaagtgtatacggtggtcgctaccagaaatg
gccagtgtcgggctgctgctggccatccacctgtgtctcttcaccatcattgggatgctg
ctgttcaccattggtgagaaggatgaagcacaggaccaggagaggctggcctacttccgg
aaccttccagaagcactgacctcactcctagtgctgctgacgacttccaacaaccctgat
gtgatgatccctgcgtatactcagaaccgggcctttgctctcttcttcatagtcttcacc
ttgataggaagcttgtttctgatgaacctgctgacagccatcatctataatcagttccgt
ggctacctaatgaaatctctacagacctcactgttccggcggcgactgggggcccgtgca
gcctacgaagtcctcgcctccagggccgggccagctggaaccacccctgagttagttggg
gtgaatcctgagaccttcctgccagtgcttcagaaaacgcagctgaacaaaacccacaaa
caagccattatgcagaaggtgcagtcctatgaaggccgcccaatgctggctgatgagttc
cagaaactcttcgatgaggttgacaaaggtttggccaaagagcgcccgctgaagccccaa
taccagtctccatttctgcagactgcccagttcatctttagccaccactacttcgactac
ctggggaacctcgtcgctctgggaaacctcttgtctatttgtgtgttcctggtgctggac
tcagacctgctgcctggggaacgtgatgactttgtcctggggattcttgactacatcttc
atcttgtactacctgctggagctgctgtttaaggtgttcgcgctgggcctgccaggctac
ctgtcctaccatagcaatgtgtttgatggcctcctcaccatcatcctgctggtttcggag
atttgcaccctggctgtataccgattgccgcactcaggatggaagccagagcagtatggc
ccactgtcgctctgggacatgacacgactgatgaacacactgattgtgtttcgcttcctg
cgcatcatccccaacataaagccaatggctgaggtagccaacaccatcctgggcctaatc
cctaacttgagggcatttggtgggatcctggtggtggcatactatgtgtttgccatgatc
gggatcaacctgttccgaggtgtcatcgtgcctcctggaaacagcagcctggttcccgac
aacaactcagctgtatgtggaagctttgagcagctaggttactggcccaacaactttgac
gactttgctgctgctttgatcacactgtggaacgtgatggtggtgaacaattggcaggtg
atcctggaagcctataagcgctacgcaggcccgtggtcaatggtgtattttgtgctatgg
tggctggtgtcctctgttatctggatcaacctgtttctggctcttcttctggagaacttt
ctccacagatgggaccctcaaggtcataagcagctccttgttgggaccaagcagatgtct
gtggagctcatgttcagggatatcctagaagagcccaaggaggaggaactgatggagaag
ctacacaaacacccacacttgcatctgtgcaggtga

DBGET integrated database retrieval system