KEGG   Mus musculus (mouse): 234673Help
Entry
234673            CDS       T01002                                 

Gene name
Ces2e, 9030624L02Rik, Ces5
Definition
carboxylesterase 2E (EC:3.1.1.88)
Orthology
K03927  
carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
mmu  Mus musculus (mouse)
Pathway
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    234673 (Ces2e)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     234673 (Ces2e)
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     234673 (Ces2e)
    3.1.1.84  cocaine esterase
     234673 (Ces2e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 D3; 8
AA seq 559 aa AA seqDB search
MPLYKLLGWLNAVACGVLLLVLHVQGQDSASPIRNTHTGQVRGSLVHVKDTDIAVHTFLG
IPFAKPPVGPLRFAPPEAPEPWSGVRDGTSHPNMCLQNDNLMGSEDLKMMNLILPPISMS
EDCLYLNIYVPAHAHEGSNLPVMVWIHGGALTVGMASMYDGSMLAATEDVVVVAIQYRLG
VLGFFSTGDQHAKGNWGYLDQVAALRWVQQNIVHFGGNPDRVTIFGESAGGTSVSSHVVS
PMSQGLFHGAIMESGVAVLPDLISSSSEMVHRIVANLSGCAAVNSETLMCCLRGKNEAEM
LAINKVFKIIPGVVDGEFLPKHPQELMASKDFHPVPSIIGINNDEYGWILPTIMDPAQKI
EEITRKTLPAVLKSTALKMMLPPECGDLLMEEYMGDTEDPETLQAQFREMKGDFMFVIPA
LQVAHFQRSHAPVYFYEFQHRPSFFKDFRPPYVKADHGDEIFLVFGYQFGNIKLPYTEEE
EQLSRRIMKYWANFARHGNPNSEGLPYWPVMDHDEQYLQLDIQPSVGRALKARRLQFWTK
TLPQKIQELKGSQERHKEL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgccactatacaaacttcttggatggctgaatgctgtggcctgtggggtcctgcttctc
gttctgcatgtgcaaggtcaggactcagccagccccatcaggaacacacacacaggccag
gtgagaggcagccttgtccacgtgaaggacactgacatcgctgttcataccttcctggga
atcccctttgccaagcctcctgtaggaccactgcgctttgcacctcctgaggcccctgag
ccatggagtggggtgagggatgggacctcacatccaaacatgtgtctacaaaatgacaat
ttgatgggttcagaggatctgaagatgatgaacttgatcctgcctcccatctctatgtct
gaggactgcctgtatctcaacatctatgtaccagcccatgcccatgagggttctaaccta
cctgtgatggtatggatccatggtggtgcactcactgttggcatggcttccatgtatgat
ggatccatgctggcagcaactgaggatgtggtggtggtcgctatccagtaccgcctgggt
gttctgggattcttcagcactggagaccagcatgccaaaggcaactggggatacctggac
caagtggctgcccttcgttgggtccagcaaaacattgtccactttggaggcaaccctgac
cgagtcaccatttttggagagtcagcaggtggcacaagtgtgtcttcacatgttgtgtcc
cccatgtcccagggactcttccatggtgccatcatggagagtggagtagctgtgctccct
gatcttatctccagctcctctgagatggttcacagaatagtggccaatctatctggctgt
gcagctgtgaactcagagaccctgatgtgctgcctaagaggcaagaatgaagcagagatg
ctggctattaataaggtcttcaaaatcatccctggtgtggtggatggagagttcctaccc
aagcatcctcaggagctgatggcctctaaggattttcaccctgtccccagcatcattggt
atcaacaatgatgaatatggttggattcttcctacgatcatggacccagctcagaaaata
gaggaaataaccagaaagaccctgccagctgttctaaaaagcacagccctaaaaatgatg
ctgcctcctgagtgtggtgacctgctaatggaggagtacatgggggacactgaggaccca
gagactctgcaagcacagttcagagagatgaagggggacttcatgttcgtgatccctgca
ctacaagtagcacattttcaacgttcccatgctcctgtctacttctatgagttccaacat
cgacccagcttcttcaaggatttcaggccaccctatgtgaaggctgaccatggtgatgaa
attttccttgtctttggctaccagttcggtaacataaaacttccttacactgaggaagag
gagcaactaagcagaaggataatgaagtactgggccaactttgcacggcacgggaacccc
aacagtgagggtctaccctactggcctgtgatggaccatgatgagcagtacctgcagctg
gacatccagccttctgtgggtcgagccctgaaggccagaaggctgcagttctggaccaag
actctgccccagaagatccaggagctaaaggggtctcaggagaggcacaaagagttgtag

DBGET integrated database retrieval system