KEGG   Mus musculus (mouse): 235339Help
Entry
235339            CDS       T01002                                 

Gene name
Dlat, 6332404G05Rik, DLTA, PDC-E2
Definition
dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    235339 (Dlat)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    235339 (Dlat)
   00020 Citrate cycle (TCA cycle)
    235339 (Dlat)
   00620 Pyruvate metabolism
    235339 (Dlat)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     235339 (Dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 A5.3; 9
AA seq 642 aa AA seqDB search
MWRVCARRARSAVPRDGFRARWAALKEGPGAPCGSPRIGPAAVRCGSGIPRYGVRSLCGW
SSGSGTVPRNRLLRQLLGSPSRRSYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE
GDLIAEVETDKATVGFESLEECYMAKILVPEGTRDVPVGSIICITVEKPQDIEAFKNYTL
DLAAAAAPQAAPAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPALSPTMTMGTVQRWEKK
VGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEKQEDIA
AFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTPSAAPAGPKGRVFVSPLAKKLA
AEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAAMAPPGPRVAPAPAGVFTDIPI
SNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKGKISVNDFIIKASA
LACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLA
SKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKG
FDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcggagggcgcggagtgctgtgcccagggatgggttcagggct
cggtgggcggccttgaaggaaggccccggggccccatgcgggagcccgcggattggcccc
gctgcggtccgttgcggtagtgggatcccccgctatggggtccgctccttgtgcggctgg
agctccggctccggcactgtcccgcgtaaccgcttgctgcgacaactcctggggtcgccc
agccgccgctcttacagcctccctccgcatcagaaggttccattaccttccctttcccct
acaatgcaggcaggcaccatagcccgctgggaaaaaaaagaaggggaaaaaatcagtgag
ggtgatctaattgcagaggttgaaactgataaagccactgttgggtttgagagcctggag
gagtgctatatggccaagatccttgttcctgaagggaccagagatgttccagttgggtcc
atcatctgtatcacagttgaaaagcctcaggatattgaggcctttaaaaattatacattg
gatttggcggcggcagctgccccacaggcagccccagctgcagccccagctccagctgct
gccccagcggcaccttctgcaagcgctcccggtagctcctatcctactcatatgcagatt
gttcttcctgccctctccccaaccatgaccatgggcacggtccagaggtgggaaaagaaa
gtgggcgagaagctgagtgaaggagacttgctggcagagatagagaccgacaaggccacc
ataggctttgaagtacaagaagaaggttatctggcaaaaatcctggtccctgaaggcaca
agggatgttcctctgggagctccactatgtatcatagtagaaaaacaggaagatatagca
gcatttgcagactacaggccaacagaagtgaccagcttaaagccacaggcagcaccacct
gccccacccccggtggcagctgttcctcccactccccagcctgtagcacctaccccctca
gctgctcctgctggaccaaagggaagggtgttcgttagtcctcttgcgaagaagttggca
gcagagaaagggattgacctcacccaagttaaagggacgggaccagaaggcagaatcatc
aagaaggacattgactcttttgtgccttctaaggctgctcctgctgcagcagctgccatg
gctcccccgggtccaagagtggcaccagctcctgcaggtgtcttcacagacatccccatc
agcaacattcgtcgagtgattgcgcagaggctcatgcagtcgaagcagactatacctcat
tattacctttctgtcgatgtaaatatgggagaggtgctgttggtacggaaggaacttaat
aagatgcttgaagggaaagggaaaatctccgtcaacgacttcattataaaggcttcagct
ttggcctgtctgaaagttcccgaagcaaactcgtcttggatggacacagttataaggcaa
aatcatgtggttgacgtcagtgttgctgtcagtacccctgcaggacttatcacccctatt
gtgtttaatgcacacataaaaggactggaaaccattgctagtgatgttgtttctttagcc
tccaaagcgagagagggtaaacttcagcctcatgagttccagggtggaacatttacaatc
tccaacttagggatgtttggaattaagaatttctctgcaattattaatccacctcaggca
tgtattctggcaatcggtgcttcagaggataaactgatcccagcagataatgagaaaggc
tttgatgtggctagtgtgatgtccgttacactcagctgtgatcatcgagttgtggatgga
gcagttggagcccagtggcttgctgaattcaaaaagtaccttgaaaagcctataactatg
ttgttataa

DBGET integrated database retrieval system