KEGG   Mus musculus (mouse): 235339Help
Entry
235339            CDS       T01002                                 

Gene name
Dlat, 6332404G05Rik, DLTA, PDC-E2
Definition
dihydrolipoamide S-acetyltransferase (E2 component of pyruvate dehydrogenase complex) (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:mmu01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mmu00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mmu00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mmu00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 A5.3; 9
AA seq 642 aa AA seqDB search
MWRVCARRARSAVPRDGFRARWAALKEGPGAPCGSPRIGPAAVRCGSGIPRYGVRSLCGW
SSGSGTVPRNRLLRQLLGSPSRRSYSLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE
GDLIAEVETDKATVGFESLEECYMAKILVPEGTRDVPVGSIICITVEKPQDIEAFKNYTL
DLAAAAAPQAAPAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPALSPTMTMGTVQRWEKK
VGEKLSEGDLLAEIETDKATIGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEKQEDIA
AFADYRPTEVTSLKPQAAPPAPPPVAAVPPTPQPVAPTPSAAPAGPKGRVFVSPLAKKLA
AEKGIDLTQVKGTGPEGRIIKKDIDSFVPSKAAPAAAAAMAPPGPRVAPAPAGVFTDIPI
SNIRRVIAQRLMQSKQTIPHYYLSVDVNMGEVLLVRKELNKMLEGKGKISVNDFIIKASA
LACLKVPEANSSWMDTVIRQNHVVDVSVAVSTPAGLITPIVFNAHIKGLETIASDVVSLA
SKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILAIGASEDKLIPADNEKG
FDVASVMSVTLSCDHRVVDGAVGAQWLAEFKKYLEKPITMLL
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgtctgtgcgcggagggcgcggagtgctgtgcccagggatgggttcagggct
cggtgggcggccttgaaggaaggccccggggccccatgcgggagcccgcggattggcccc
gctgcggtccgttgcggtagtgggatcccccgctatggggtccgctccttgtgcggctgg
agctccggctccggcactgtcccgcgtaaccgcttgctgcgacaactcctggggtcgccc
agccgccgctcttacagcctccctccgcatcagaaggttccattaccttccctttcccct
acaatgcaggcaggcaccatagcccgctgggaaaaaaaagaaggggaaaaaatcagtgag
ggtgatctaattgcagaggttgaaactgataaagccactgttgggtttgagagcctggag
gagtgctatatggccaagatccttgttcctgaagggaccagagatgttccagttgggtcc
atcatctgtatcacagttgaaaagcctcaggatattgaggcctttaaaaattatacattg
gatttggcggcggcagctgccccacaggcagccccagctgcagccccagctccagctgct
gccccagcggcaccttctgcaagcgctcccggtagctcctatcctactcatatgcagatt
gttcttcctgccctctccccaaccatgaccatgggcacggtccagaggtgggaaaagaaa
gtgggcgagaagctgagtgaaggagacttgctggcagagatagagaccgacaaggccacc
ataggctttgaagtacaagaagaaggttatctggcaaaaatcctggtccctgaaggcaca
agggatgttcctctgggagctccactatgtatcatagtagaaaaacaggaagatatagca
gcatttgcagactacaggccaacagaagtgaccagcttaaagccacaggcagcaccacct
gccccacccccggtggcagctgttcctcccactccccagcctgtagcacctaccccctca
gctgctcctgctggaccaaagggaagggtgttcgttagtcctcttgcgaagaagttggca
gcagagaaagggattgacctcacccaagttaaagggacgggaccagaaggcagaatcatc
aagaaggacattgactcttttgtgccttctaaggctgctcctgctgcagcagctgccatg
gctcccccgggtccaagagtggcaccagctcctgcaggtgtcttcacagacatccccatc
agcaacattcgtcgagtgattgcgcagaggctcatgcagtcgaagcagactatacctcat
tattacctttctgtcgatgtaaatatgggagaggtgctgttggtacggaaggaacttaat
aagatgcttgaagggaaagggaaaatctccgtcaacgacttcattataaaggcttcagct
ttggcctgtctgaaagttcccgaagcaaactcgtcttggatggacacagttataaggcaa
aatcatgtggttgacgtcagtgttgctgtcagtacccctgcaggacttatcacccctatt
gtgtttaatgcacacataaaaggactggaaaccattgctagtgatgttgtttctttagcc
tccaaagcgagagagggtaaacttcagcctcatgagttccagggtggaacatttacaatc
tccaacttagggatgtttggaattaagaatttctctgcaattattaatccacctcaggca
tgtattctggcaatcggtgcttcagaggataaactgatcccagcagataatgagaaaggc
tttgatgtggctagtgtgatgtccgttacactcagctgtgatcatcgagttgtggatgga
gcagttggagcccagtggcttgctgaattcaaaaagtaccttgaaaagcctataactatg
ttgttataa

DBGET integrated database retrieval system