KEGG   Mus musculus (mouse): 235441Help
Entry
235441            CDS       T01002                                 

Gene name
Usp3, AA409661, BC017156
Definition
ubiquitin specific peptidase 3 (EC:3.4.19.12)
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     235441 (Usp3)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   235441 (Usp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 C; 9
AA seq 520 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQIPLLNHKRSEKQEKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSSLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDSNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGP
VCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKALCLHLKRFHWTAYL
RNKVDTYVQFPLRGLDMKCYLLEPENSGPDSCLYDLAAVVVHHGSGVGSGHYTAYAVHEG
RWFHFNDSTVTVTDEETVGKAKAYILFYVERQARAGAEKL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccgcacctcagctccagcgtctgcatcgccccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgcaggtccaacaaaagcccctgggtc
tgtttgacttgttcaagtgtccactgtggaaggtatgtgaatggccatgcaaaaaaacat
tatgaagatgcacagatacccttactcaaccataagagatcagaaaagcaggagaaagct
cagcatacagtgtgtatggattgcagtagctacagcacatactgttatcgctgtgacgat
tttgtggtcaacgacaccaagctgggcctggtacagaaagtgagagaacacttacagaac
ttggaaaactcagcctttacagcggacaggcacagaaaaagaaaattattggaaaactca
tcactaaacagcaagttattaaaagtaaatggaagtacgactgccatttgtgccacaggc
cttcgaaatttgggcaacacttgtttcatgaatgctatccttcagtcactcagtaacatt
gagcagttttgctgttatttcaaagaactgcctgctgtggagttaaggaatgggaaaaca
gcaggaaggcgaacataccacaccaggagccaaggggacagcaatgtgtctttagtagaa
gagtttagaaagacactgtgtgctttatggcaaggcagccagactgcatttagtcctgag
tccttgttttatgttgtctggaagatcatgcctaactttaggggttatcagcagcaggat
gcccatgaattcatgcgctaccttttggatcatctacacttagaacttcagggtggcttc
aatggtgtttcccgctcagcaattctacaggagaattctacactgtctgcaagtaacaaa
tgctgcataaatggagcatcaactgttgtcacagcaatatttggaggaattctccagaac
gaggtcaactgcctcatatgtgggacagagtcgaggaagtttgatccattcctagatctc
tccttagatattccaagtcagttcagaagcaagcgctctaagaatcaggaaaatgggcca
gtttgctccttaagagattgccttcgcagcttcactgacctagaggaacttgatgagaca
gagttgtatatgtgccataagtgcaaaaagaaacaaaagtccacaaagaagttttggatt
caaaaacttcccaaggcactgtgcttgcacctgaaaaggtttcactggacagcatattta
agaaacaaagtcgatacatacgttcaattcccactgagaggcctggacatgaagtgctac
ctactagagccggagaacagtggtccagacagttgcctgtatgacctcgctgctgtggtt
gtacaccatggctctggggttggttctggacattacacagcatatgcagttcacgaaggc
cgctggttccatttcaatgacagcactgtgacagtgactgatgaggagaccgttgggaag
gcaaaggcctacattctgttttatgtggagcgtcaggccagagctggagcagaaaaactg
taa

DBGET integrated database retrieval system