KEGG   Mus musculus (mouse): 235441Help
Entry
235441            CDS       T01002                                 

Gene name
Usp3, AA409661, BC017156
Definition
(RefSeq) ubiquitin specific peptidase 3 (EC:3.4.19.12)
  KO
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     235441 (Usp3)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   235441 (Usp3)
Ubiquitin system [BR:mmu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    235441 (Usp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 C
AA seq 520 aa AA seqDB search
MECPHLSSSVCIAPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQIPLLNHKRSEKQEKAQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSSLNSKLLKVNGSTTAICATGLRNLGNTCFMNAILQSLSNI
EQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDSNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSAILQENSTLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRSKRSKNQENGP
VCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKALCLHLKRFHWTAYL
RNKVDTYVQFPLRGLDMKCYLLEPENSGPDSCLYDLAAVVVHHGSGVGSGHYTAYAVHEG
RWFHFNDSTVTVTDEETVGKAKAYILFYVERQARAGAEKL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggagtgtccgcacctcagctccagcgtctgcatcgccccggactcagccaagttcccc
aacggctccccgtcgtcctggtgctgcagcgtgtgcaggtccaacaaaagcccctgggtc
tgtttgacttgttcaagtgtccactgtggaaggtatgtgaatggccatgcaaaaaaacat
tatgaagatgcacagatacccttactcaaccataagagatcagaaaagcaggagaaagct
cagcatacagtgtgtatggattgcagtagctacagcacatactgttatcgctgtgacgat
tttgtggtcaacgacaccaagctgggcctggtacagaaagtgagagaacacttacagaac
ttggaaaactcagcctttacagcggacaggcacagaaaaagaaaattattggaaaactca
tcactaaacagcaagttattaaaagtaaatggaagtacgactgccatttgtgccacaggc
cttcgaaatttgggcaacacttgtttcatgaatgctatccttcagtcactcagtaacatt
gagcagttttgctgttatttcaaagaactgcctgctgtggagttaaggaatgggaaaaca
gcaggaaggcgaacataccacaccaggagccaaggggacagcaatgtgtctttagtagaa
gagtttagaaagacactgtgtgctttatggcaaggcagccagactgcatttagtcctgag
tccttgttttatgttgtctggaagatcatgcctaactttaggggttatcagcagcaggat
gcccatgaattcatgcgctaccttttggatcatctacacttagaacttcagggtggcttc
aatggtgtttcccgctcagcaattctacaggagaattctacactgtctgcaagtaacaaa
tgctgcataaatggagcatcaactgttgtcacagcaatatttggaggaattctccagaac
gaggtcaactgcctcatatgtgggacagagtcgaggaagtttgatccattcctagatctc
tccttagatattccaagtcagttcagaagcaagcgctctaagaatcaggaaaatgggcca
gtttgctccttaagagattgccttcgcagcttcactgacctagaggaacttgatgagaca
gagttgtatatgtgccataagtgcaaaaagaaacaaaagtccacaaagaagttttggatt
caaaaacttcccaaggcactgtgcttgcacctgaaaaggtttcactggacagcatattta
agaaacaaagtcgatacatacgttcaattcccactgagaggcctggacatgaagtgctac
ctactagagccggagaacagtggtccagacagttgcctgtatgacctcgctgctgtggtt
gtacaccatggctctggggttggttctggacattacacagcatatgcagttcacgaaggc
cgctggttccatttcaatgacagcactgtgacagtgactgatgaggagaccgttgggaag
gcaaaggcctacattctgttttatgtggagcgtcaggccagagctggagcagaaaaactg
taa

DBGET integrated database retrieval system