KEGG   Mus musculus (mouse): 235442Help
Entry
235442            CDS       T01002                                 

Gene name
Rab8b, 5930437D16, D330025I23Rik
Definition
(RefSeq) RAB8B, member RAS oncogene family
  KO
K07902  
Ras-related protein Rab-8B
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab GTPases
    235442 (Rab8b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   235442 (Rab8b)
  Exosomal proteins of other body fluids (saliva and urine)
   235442 (Rab8b)
  Exosomal proteins of colorectal cancer cells
   235442 (Rab8b)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab8/10/13 [OT]
    235442 (Rab8b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9; 9 C
AA seq 207 aa AA seqDB search
MAKTYDYLFKLLLIGDSGVGKTCLLFRFSEDAFNTTFISTIGIDFKIRTIELDGKKIKLQ
IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIKNWIRNIEEHASSDVERMILG
NKCDMNDKRQVSKERGEKLAIDYGIKFLETSAKSSTNVEEAFFTLARDIMTKLNRKMNDS
NSSGAGGPVKITESRSKKTSFFRCSLL
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagacgtacgattatctgttcaagctgctgctcatcggcgactccggcgttggc
aagacctgcctcctgttccgcttctcagaggacgccttcaacaccacctttatctccacc
atcggaattgattttaaaatcagaacgatagaactcgacggaaagaaaattaaacttcag
atatgggacacggcgggccaggaaagattccgaacaattacgacagcatactatagagga
gccatgggaattatgctggtctatgacatcaccaatgaaaaatcctttgacaatattaaa
aattggataagaaacattgaagagcacgcctcttcagatgttgaaagaatgatcctgggt
aacaaatgtgatatgaacgacaaaagacaagtgtcgaaagagagaggggagaagttagca
attgactatgggattaaatttttggagacaagtgcaaagtcgagtacaaatgtagaagag
gcattttttacacttgcacgggatataatgacaaaactcaacaggaaaatgaacgacagc
aattcatcaggagcaggtgggccagtgaagataacagagagccggtctaagaagaccagt
ttcttccgctgttctctgctttga

DBGET integrated database retrieval system