KEGG   Mus musculus (mouse): 235504Help
Entry
235504            CDS       T01002                                 

Gene name
Slc17a5, 4631416G20Rik, 4732491M05, AST, ISSD, NSD, SD, SIALIN, SIASD, SLD
Definition
solute carrier family 17 (anion/sugar transporter), member 5
Orthology
K12301  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 5
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Class
Cellular Processes; Transport and catabolism; Lysosome [PATH:mmu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 E1; 9
AA seq 469 aa AA seqDB search
MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAILAFCGFFVLYALRVNL
SVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTIPGGYIASRVGGKLLLGLGILGT
SVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFPAMHAMWSSWAPPLERSKLLTISYAGA
QLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVWFILWMWIVSDTPETHKTISHYEKEYI
VSSLKNQLSSQKVVPWGSILKSLPLWAIVVAHFSYNWSFYTLLTLLPTYMKEILRFNVQE
NGFLSALPYFGCWLCMILCGQAADYLRVKWNFSTISVRRIFSLVGMVGPAVFLVAAGFIG
CDYSLAVAFLTISTTLGGFASSGFSINHLDIAPSYAGILLGITNTFATIPGMTGPIIAKS
LTPDNTIREWQTVFCIAAAINVFGAIFFTLFAKGEVQSWALSDHHGHRN
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccctgcttcggggtccggcgggaaacgacgatgaggagagctcggacagcacc
ccgctcctgccgggcgcccggcagaccgaagcggctccagtgtgctgctctgctcggtac
aacttagcgattttggcgttctgtggtttcttcgttctctatgccttacgggtgaacctg
agtgttgcgttagtggacatggtagattcaaatacaactctgactgataatagaacgtct
aaggagtgtgcggaacattctgcccccataaaagttcaccacaatcacacaattcccggt
gggtacattgccagcagggtcggagggaagctgctgctgggcctgggcatcttaggcacc
tccgtcttcaccctgttcacaccgctggccgcagacttaggcgtggtgactctcgttgtg
cttagagcgctggaaggactgggagagggtgttacgtttccagctatgcacgccatgtgg
tcttcctgggctccccctctggaaagaagcaagcttcttaccatttcctatgcgggagca
cagcttgggacagtgatctcacttcctctttccggaataatatgctactatatgaactgg
acttacgtcttctatctttttggtatagttggaattgtctggtttattttatggatgtgg
atagtcagtgatacaccagaaactcacaagacaatctcccattatgaaaaagaatacatt
gtttcatcattaaaaaatcagctttcttcgcagaaggtggtgccgtgggggtccatcttg
aagtcactgccactttgggcaattgtggtagcacatttctcctacaactggtctttttac
accttattgacgctactgccaacttatatgaaggaaatcctaaggttcaatgttcaagag
aacgggtttttatctgcattgccttattttggctgttggttatgcatgatcctctgtggt
caagccgctgactatttaagggtcaagtggaacttttcaactataagcgttcggagaatt
tttagcctcgtaggaatggttggccctgcggttttcctagtcgcggctggatttataggc
tgtgactattccttggccgttgcgttcctaaccatatccacgacgctgggaggcttcgcc
tcttctggatttagcatcaaccatctggatatcgctccttcgtatgctggcatcctcttg
ggcatcacaaacacgtttgccactattcccgggatgacgggacccatcattgctaaaagt
ctgacccctgataacactattagggaatggcagactgtcttctgtatcgctgctgctatt
aacgtgtttggggccattttcttcacgctgtttgccaaaggggaagtgcagagctgggct
ctcagtgaccaccacggacacagaaactga

DBGET integrated database retrieval system