KEGG   Mus musculus (mouse): 235504Help
Entry
235504            CDS       T01002                                 

Gene name
Slc17a5, 4631416G20Rik, 4732491M05, AST, ISSD, NSD, SD, SIALIN, SIASD, SLD
Definition
(RefSeq) solute carrier family 17 (anion/sugar transporter), member 5
  KO
K12301  
MFS transporter, ACS family, solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 5
Organism
mmu  Mus musculus (mouse)
Pathway
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    235504 (Slc17a5)
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC17: Vesicular glutamate transporter
   235504 (Slc17a5)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Anion:cation symporter (ACS) family [TC:2.A.1.14]
    235504 (Slc17a5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 E1
AA seq 495 aa AA seqDB search
MRPLLRGPAGNDDEESSDSTPLLPGARQTEAAPVCCSARYNLAILAFCGFFVLYALRVNL
SVALVDMVDSNTTLTDNRTSKECAEHSAPIKVHHNHTGKKYKWDAETQGWILGSFFYGYI
VTQIPGGYIASRVGGKLLLGLGILGTSVFTLFTPLAADLGVVTLVVLRALEGLGEGVTFP
AMHAMWSSWAPPLERSKLLTISYAGAQLGTVISLPLSGIICYYMNWTYVFYLFGIVGIVW
FILWMWIVSDTPETHKTISHYEKEYIVSSLKNQLSSQKVVPWGSILKSLPLWAIVVAHFS
YNWSFYTLLTLLPTYMKEILRFNVQENGFLSALPYFGCWLCMILCGQAADYLRVKWNFST
ISVRRIFSLVGMVGPAVFLVAAGFIGCDYSLAVAFLTISTTLGGFASSGFSINHLDIAPS
YAGILLGITNTFATIPGMTGPIIAKSLTPDNTIREWQTVFCIAAAINVFGAIFFTLFAKG
EVQSWALSDHHGHRN
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaggcccctgcttcggggtccggcgggaaacgacgatgaggagagctcggacagcacc
ccgctcctgccgggcgcccggcagaccgaagcggctccagtgtgctgctctgctcggtac
aacttagcgattttggcgttctgtggtttcttcgttctctatgccttacgggtgaacctg
agtgttgcgttagtggacatggtagattcaaatacaactctgactgataatagaacgtct
aaggagtgtgcggaacattctgcccccataaaagttcaccacaatcacacaggtaaaaag
tacaagtgggatgcagaaactcaagggtggattctcggctcttttttttacggctacatc
gtcacccagattcccggtgggtacattgccagcagggtcggagggaagctgctgctgggc
ctgggcatcttaggcacctccgtcttcaccctgttcacaccgctggccgcagacttaggc
gtggtgactctcgttgtgcttagagcgctggaaggactgggagagggtgttacgtttcca
gctatgcacgccatgtggtcttcctgggctccccctctggaaagaagcaagcttcttacc
atttcctatgcgggagcacagcttgggacagtgatctcacttcctctttccggaataata
tgctactatatgaactggacttacgtcttctatctttttggtatagttggaattgtctgg
tttattttatggatgtggatagtcagtgatacaccagaaactcacaagacaatctcccat
tatgaaaaagaatacattgtttcatcattaaaaaatcagctttcttcgcagaaggtggtg
ccgtgggggtccatcttgaagtcactgccactttgggcaattgtggtagcacatttctcc
tacaactggtctttttacaccttattgacgctactgccaacttatatgaaggaaatccta
aggttcaatgttcaagagaacgggtttttatctgcattgccttattttggctgttggtta
tgcatgatcctctgtggtcaagccgctgactatttaagggtcaagtggaacttttcaact
ataagcgttcggagaatttttagcctcgtaggaatggttggccctgcggttttcctagtc
gcggctggatttataggctgtgactattccttggccgttgcgttcctaaccatatccacg
acgctgggaggcttcgcctcttctggatttagcatcaaccatctggatatcgctccttcg
tatgctggcatcctcttgggcatcacaaacacgtttgccactattcccgggatgacggga
cccatcattgctaaaagtctgacccctgataacactattagggaatggcagactgtcttc
tgtatcgctgctgctattaacgtgtttggggccattttcttcacgctgtttgccaaaggg
gaagtgcagagctgggctctcagtgaccaccacggacacagaaactga

DBGET integrated database retrieval system