KEGG   Mus musculus (mouse): 235606Help
Entry
235606            CDS       T01002                                 

Gene name
Apeh
Definition
(RefSeq) acylpeptide hydrolase
  KO
K01303  acylaminoacyl-peptidase [EC:3.4.19.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.1  acylaminoacyl-peptidase
     235606 (Apeh)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   235606 (Apeh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S9 Hydrolase_4 Abhydrolase_1 DLH Peptidase_S15 Abhydrolase_3 COesterase Abhydrolase_2 Abhydrolase_6 BAAT_C Peptidase_S28 Esterase Esterase_phd PhoPQ_related Tannase
Motif
Other DBs
NCBI-GeneID: 235606
NCBI-ProteinID: NP_666338
MGI: 88041
Ensembl: ENSMUSG00000032590
Vega: OTTMUSG00000050818
UniProt: Q8R146
Position
9 F1; 9 59.07 cM
AA seq 732 aa AA seqDB search
MERQVLLSEPQEAAALYRGLSRQPSLSAACLGPEVTTQYGGLYRTVHTEWTQRDLDRMEN
IRFCRQYLVFHDGDSVVFAGPAGNSVETRGELLSRESPSGTMKAVLRKAGGAVSGEEKQF
LEVWEKNRKLKSFNLSALEKHGPVYEDDCFGCLSWSHSETHLLYVAEKKRPKAESFFQTK
ALDVSASDEEMARPKKPDQAIKGDQFVFYEDWGETMVSKSIPVLCVLDIESGNISVLEGV
PENVSPGQAFWAPGDTGVVFVGWWHEPFRLGIRYCTNRRSALYYVDLSGGKCELLSDESL
AVCSPRLSPDQCRVVYLQYPSLAPHHQCSQLFLYDWYTKVTSLVVDIVPRQLGESFSGIY
CSLLPLGCWSADSQRVVFDSVQRSRQDLFAVDTQTGSVTSLTAGGSAGSWKLLTIDRDLM
VAQFSTPNLPPSLKVGFLPPAGKEQSVSWVSLEEAEPIPDIHWGIRVLHPPPDQENVQYA
DLDFEAILLQPSNSPDKSQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGS
TGFGQDSILSLPGNVGHQDVKDVQFAVQQVLQEEHFDARRVALMGGSHGGFLSCHLIGQY
PETYSACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLEEMLDKSPIKYI
PQVKTPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHALSEVEVESDSFM
NTVLWLHTHLGS
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggagcgtcaggtgctgctgagtgagccccaggaggcggcagcgctgtaccggggcctt
agccgccagccttcgctgagcgccgcctgcctgggcccggaggtcaccacgcagtatggg
ggcctctatcggactgtgcacactgagtggactcagagggacttggatcgaatggagaac
atccgattctgccgccagtacctagtgttccatgatggagactcggtggtgtttgccggg
cctgcgggcaacagtgtggaaacccggggggagctgctgagcagagagtctccttcaggc
accatgaaagcagtgctgcgcaaggctggaggtgcagtctcgggagaggaaaaacagttc
ttggaggtctgggagaagaaccgcaagctcaagagtttcaacctgtctgcactggagaag
catgggcctgtgtatgaagatgactgctttggctgcctctcctggtcacactcagagacg
cacttgttgtatgtggcggagaagaagcgtcccaaagctgagtccttctttcaaaccaaa
gccttggacgtcagtgccagtgatgaggagatggccaggccgaagaagccagaccaggcc
atcaagggggaccagtttgtattttatgaagactggggagaaactatggtttccaaaagc
atccctgtgctctgcgtgctggatatcgagagtggtaacatctccgtgcttgagggcgtc
cctgaaaatgtgtcccctggtcaggctttctgggcccctggagacacgggtgtggtgttt
gtgggctggtggcacgaacccttccggctaggtatccgctactgcaccaatcgcaggtca
gccctgtactatgtggacctgagcggggggaagtgtgaactactctcggatgagtccctg
gctgtctgctctcctcggctgagcccagaccagtgtcgcgtcgtctacctgcagtaccca
tctctagcccctcatcaccagtgcagccagctcttcctgtatgactggtacaccaaggtc
acctcattggtggtggacattgtacctcggcagctgggagagagcttctctgggatctac
tgcagcctccttcctttgggatgctggtcagctgacagccagagagtggtcttcgactcg
gtccagcgcagtcggcaggacctgtttgctgtggacacccagacaggaagtgtcacctcc
ctgacagctggggggtcagcgggaagctggaagctgcttacaattgaccgagaccttatg
gtggcccagttctccacacccaacctgcccccgagcctgaaagtcgggttcctgcctcct
gctgggaaggagcagtctgtgtcatgggtgtcactggaggaggctgaacctattcctgac
atccactggggcatccgagtgctgcacccacctccagaccaagagaatgtacaatatgct
gaccttgactttgaagcaatcctcctgcagcccagcaactctccagataagagccaggtc
cccatggtagtcatgccccatgggggaccccactcttcctttgtcactgcctggatgctg
ttcccagccatgctttgcaagatgggctttgcagtactactggtgaactatcgtggttcc
acgggctttggccaagacagcatcctttccctcccaggcaatgtgggccaccaggatgtg
aaggatgtccagttcgcagtgcagcaggtgctccaggaggaacactttgatgcaagacgt
gtggcccttatgggtggttcccatggtgggttcctctcctgccacctgattggtcaatac
ccagaaacctacagtgcctgtatagcccggaacccagtgatcaacattgtctccatgatg
ggcaccactgacatccctgattggtgtatggtggagactggcttcccttatagtaatgac
tacctgccagacctgaatgtgttggaagagatgctggataaatcacccatcaagtacatc
cctcaggtaaagacaccagtgttactgatgctgggccaggaggaccggcgtgtacccttc
aagcagggtctggagtattaccatgccctcaaggcccggaatgtgcctgtccggctcctg
ctgtatcccaagagcacccatgcgctgtcagaggtggaggtggaatcagacagcttcatg
aacactgtgctttggctacacacacacttgggcagctga

DBGET integrated database retrieval system