KEGG   Mus musculus (mouse): 236900Help
Entry
236900            CDS       T01002                                 

Gene name
Pdk3, 2610001M10Rik, AI035637
Definition
pyruvate dehydrogenase kinase, isoenzyme 3 (EC:2.7.11.2)
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X C3; X
AA seq 415 aa AA seqDB search
MRLFYRLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPRVLDNFLNVLINIRNRHN
DVVPTMAQGVIEYKEKFGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPAH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPNKPIQVVYVPSH
LFHMLFELFKNSMRATVELHEDKKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQDKIKSNRTF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcttctaccggctgctcaagcagccggtccccaagcagatcgagcgctactcc
cgcttctccccgtcgccactgtctatcaaacagttcctggacttcggaagggataatgca
tgtgaaaaaacttcctatatgtttctgcgcaaggaacttcctgtgcgactggctaacacc
atgagagaggttaatctcttgccggataacttgttgaaccgcccttccgtgggattagtt
cagagctggtacatgcagagcttccttgaacttttagaatatgaaaacaagagcccagaa
gacccacgagttttggataactttctcaacgttctgataaatatcagaaacagacacaat
gatgttgttcctacaatggcccaaggcgtgattgagtacaaggaaaagttcgggtttgat
ccgttcattagcagtaacattcaatatttcctggatcggttttataccaaccgcatttct
ttccgcatgcttattaaccagcacacacttctgtttggtggtgacactaaccctgcacat
ccgaaacatatagggagtatcgaccccacctgtaatgtagctgatgtggttaaagatgca
tatgaaacagccaagatgctttgtgaacagtattacctggtagctccagagctagaagtt
gaagaattcaatgccaaagcgccaaacaaacccattcaggtagtttatgtgccgtcacat
ctgtttcacatgctatttgagctgttcaagaactcaatgagggcaacagttgaactacat
gaagataaaaaagaaggctacccagctgttaaaactctcgttactctgggtaaagaagac
ttgtccattaagataagtgacctaggtggtggagtcccacttcgaaaaatagaccgtctt
tttaactacatgtactcaactgctcctcgtcccagcctggagcctacaagagcggcgccc
ttggctggatttggttatggcttgccaatttctcgtctgtatgccagatattttcaggga
gatctaaaactgtattccatggaaggagtgggtaccgatgcagtcatttatttgaaggcc
ctttcaagtgaatcctttgagaggctgccagttttcaataagtctgcatggcgccattac
aagaccactcctgaagctgatgactggagcaatcccagcagtgaaccaagggatgcatca
aaatacaaggctaaacaggacaagatcaagagtaatagaactttctag

DBGET integrated database retrieval system