KEGG   Mus musculus (mouse): 237459Help
Entry
237459            CDS       T01002                                 

Gene name
Cdk17, 6430598J10Rik, Pctk2
Definition
(RefSeq) cyclin-dependent kinase 17 (EC:2.7.11.22)
  KO
K15595  
cyclin-dependent kinase 17 [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     237459 (Cdk17)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   237459 (Cdk17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 C2
AA seq 523 aa AA seqDB search
MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEESSSKDNEPIVKNGRPPTSHSVHSFLHQ
YTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEV
QSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQISSPPFDQPMSRRSRRAS
LSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVS
LLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRG
LAYCHRRKVLHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVL
LGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGVSSND
EFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVPAEEAMKHVYFRSLGPRI
HALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtttaagaggagactgtccctcacgctcaggggaagccagacgattgatgag
tcgctgtcagagctggctgagcagatgaccatagaggagagcagtagcaaggacaacgag
cccattgtgaagaatggcaggccgcccacgtctcacagcgtgcattccttcctccatcag
tacacaggctccttcaagaagcccccgttgcggagaccccacagtgttattggaggaagc
cttggttccttcatggcaatgcccaggaatggaagcagactagatattgttcatgaaaat
ctgaagatgggatcagatggtgagagtgaccaagcttctgggacatcatctgatgaagtc
cagtcacctacaggtgtttgcctcagaaatcgtatacatagacggatctcaatggaggac
ttgaataagcggctgtcgctgcctgcagacatcaggatacctgatggctacctggagaag
ctgcagatcagcagcccaccctttgaccagcccatgagccgcaggtcccgcagagcttcc
ttatcagaaattgggtttgggaaaatggaaacctacatcaaattggaaaagctcggagag
ggtacatatgcaacagtatataaaggaagaagtaaactgacagaaaatttggtggcatta
aaagagatccgcttggaacacgaagaaggtgcaccctgtacagctataagagaagtttca
ctgttaaaggatttaaaacatgcaaatatagtaaccttgcacgacatcgttcacacagac
aaatctttgactctggtctttgagtacctggacaaagacctgaagcaatacatggatgac
tgtgggaacatcatgagcatgcacaatgtcaagctgttcctgtaccaaattctccgtggt
ctggcatattgccatagaagaaaagtgttgcaccgggacttgaaaccacagaacctcctc
attaatgagagaggagaactaaagctggctgactttggactagccagagccaagtcagtt
cccacaaagacctactcaaatgaagttgtcaccctgtggtatcgaccacctgatgtgctt
cttggttcctcagaatactcaacacagatcgacatgtggggagttggctgtattttcttt
gaaatggcttctggaagaccactgtttccagggtcaactgtggaagatgaactgcattta
atatttcgactactaggaactccatctcaggaaacttggccaggtgtttcttcaaatgat
gaattcaagaactacaacttcccaaaatacaagccacaacctctaattaatcatgcaccc
aggttagattctgaaggaattgaattgataacaaaatttcttcagtatgaatctaagaag
agggttccggcagaagaggccatgaagcacgtgtacttccgcagcctggggccgaggatc
catgctttgcccgagagcgtatcaatattcagtttgaaagagattcagttgcaaaaggac
ccgggttttcgaaactcttcttatccagagacaggacatgggaagaacagaagacagagc
atgctcttttaa

DBGET integrated database retrieval system