KEGG   Mus musculus (mouse): 237898Help
Entry
237898            CDS       T01002                                 

Gene name
Usp32, 2900074J03Rik, 6430526O11Rik, AW045245
Definition
ubiquitin specific peptidase 32 (EC:3.1.2.15)
Orthology
K11837  
ubiquitin carboxyl-terminal hydrolase 6/32 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     237898 (Usp32)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   237898 (Usp32)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 C; 11
AA seq 1604 aa AA seqDB search
MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMSQHCFIREVLGDGVPPKV
AEVIYCSFGGTSKGLHFNNLIVGLVLLTRGKDEEKAKYIFSLFSSESGSYVVREEMERML
HVVDGKVPDTLRKCFSEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTPT
FYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEGLFNAF
DENRDNHIDFKEISCGLSACCRGPLAERQKFCFKVFDVDRDGVLSRVELKDMVVALLEVW
KDNRTDDIPELHMDLSDIVERILNAHDTTKVGHLTLEDYQIWSVKNVLANEFLNLLFQVC
HIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKYDASPVVI
EPSSVLNGGKFSFGTAAHPIEHGEDRISNNLGYMNTTEEKYSDNISSASEASESTGSGFL
YSGTPGADMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVTQEPVKATSL
TLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGSNLALPRPVIKNSKTDIPELELFPR
YLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIKEIHEYLSQRLR
IKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMSWPEEMSFIANSS
KIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMK
GHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDSQELLAFLLDGLHED
LNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHGQLRSQVKCKTCGHIS
VRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRLNMDEKYTGLKKQLSDLCGLK
SEQILFAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPIPASPVSACSPIQTDCSSSPST
NGLFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNVTNGIVNGHMPPLPDDPFTGYIIAVH
RKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDAVWIQVSRLASPLPPQEASN
HAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCKIDCGEDRAFIGNACIAVDWD
PTALHLRYQTSQERVVEEHESVEQSRRAQAEPINLDSCLRAFTSEEELGENEMYYCSKCK
THCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKIVKFPRESFDPSAFLVPRDPTLC
QHKPLTPQGDDFSELRIPAGDVKKVDIQSSAGEEDVLLSKSPSSLSANVTSSPKGSPSSS
RKSGASCPSSKNSSPNSSPRTLGRNKGRLRLPQIGSKNKLSNSKENLDTSKENGAGQICE
LADTLNRRHVLGGSQPELVTPLDHEITLANGFLYEHEACGNGYSNGQLGNHSEEDSTDDQ
REETHSKPIYNLYAISCHSGILGGGHYVTYAKNPNCKWYCYNDSSCKELHPDEIDTDSAY
ILFYEQQGIDCAQFLPKTDGKKMADTSSMDEDFESDYKKYCVLQ
NT seq 4815 nt NT seq  +upstreamnt  +downstreamnt
atgggcgccaaggagtcacggatcggattcctcagctacgaggaggcgctgaggagagtt
acagatgttgagctgaaacgactcaaagatgccttcaagaggacctgcggcctctcctat
tacatgagtcagcactgcttcatcagggaagtgcttggggatggagtacctcctaaagtt
gctgaggtgatttactgttcttttggtggaacatccaaagggctgcatttcaataactta
atagttggactcgtcctccttacaagaggcaaagatgaagagaaagcaaaatatattttt
agtcttttttcaagtgaatccgggagctatgttgtacgggaagaaatggagagaatgctc
catgtggtggatggtaaagtcccagatacactcaggaagtgtttctcagagggtgaaaag
gtaaactatgaaaaattcagaaattggcttcttctaaacaaagatgcttttaccttctct
cgctggctgttgtctgggggtgtatatgtgaccctcactgatgacagtgacactcctact
ttctaccaaactctggctggagtcacacatttggaagagtcagacatcatcgatctggag
aaacggtattggctactgaaggcccaatcccgaactggacgttttgacttagagaccttt
ggtccattggtttcaccacctattcgcccttctctgagtgaaggattatttaatgctttt
gatgaaaatcgtgacaatcacatagacttcaaggagatatcctgtgggttatcagcctgc
tgcaggggccccctggctgaaagacaaaaattttgcttcaaggtgtttgatgttgaccgt
gatggagttctctccagggttgaactgaaagacatggtagttgcacttttggaggtctgg
aaagataaccgcactgatgatattcctgaattgcatatggatttgtcagacattgtagaa
aggatattgaatgcacatgataccacaaaggtgggccatcttactcttgaagactatcag
atatggagtgtgaaaaatgttcttgccaatgagtttttgaatctcctcttccaggtatgc
cacatagttctggggttaagaccagctactccagaagaagaaggacaaattattagagga
tggttggaacgagaaagcaggtatggtctgcagccaggacacaattggtttatcatctcc
atgcagtggtggcaacagtggaaagaatatgtcaaatatgatgccagccctgttgtaatt
gagccatcatctgttctaaatggaggaaaattttcatttggaacagcagcacatcctata
gagcatggagaagatagaatcagtaataaccttggttatatgaataccacagaagagaaa
tactcagacaacatttcttctgcatctgaagcctcagagtctactggcagtggctttctg
tattctggcacaccaggggcagatatgtgctttgcaaggcagcataacacttctgacaat
aacaaccagtgtttactaggagccaatgggaatatccttttgcaccttaatcctcagaag
ccaggagcaattgataaccagccactagtaactcaggaaccagtaaaggctacatcatta
acactagaaggagggcgattaaaacgaactccacagctaatccatggaagagattatgaa
atggtcccagaacccgtgtggagagcactttatcattggtatggatcaaacctggccctt
cctagaccagtaatcaagaatagcaaaacggacatcccagaactagaattatttcctcgc
tatcttctcttccttcgacagcagcctgccacacggacacagcaatctaacatctgggtg
aatatgggaaatgtaccctctccaaatgcgcctctaaagcgagtgttagcctatacaggc
tgttttagtagaatgcaaaccatcaaggaaattcatgaatatctgtctcaaaggcttcgc
attaaagaggaagatatgcggctgtggctgtacaatagtgagaactacctgactcttctg
gatgatgaggatcacagattggaatatttgaaaatccaggatgagcagcacctggtaatt
gaagttcgaaacaaagatatgagttggcctgaagaaatgtcttttatagcaaacagtagc
aaaatagatagacataaagttcccacagaaaagggcgccacaggtctgagtaacctggga
aacacatgcttcatgaactcaagcatccagtgtgtcagcaatacacaaccactgacacag
tactttatctcagggaggcatctttatgaactcaacaggacaaatcccattggtatgaaa
ggccatatggctaaatgttatggcgatttggtgcaagaactttggagtggaactcagaag
aatgttgcccccttaaagctccggtggaccatagcaaaatatgctcccaggtttaatgga
ttccagcaacaagactcccaagaacttctggctttcctcttggatggtcttcatgaagat
ctcaaccgagtccacgagaaaccatatgtagaactaaaagacagtgacggccgacccgac
tgggaagtagctgcagaggcctgggacaaccatctaaggagaaatagatcaattgttgtg
gacttgttccatggtcagctaagatcccaagtcaaatgcaagacatgtgggcatataagt
gtccgattcgacccttttaattttttgtctttaccactaccaatggacagttacatgcat
ttagaaataacagtaattaaattagatggtactacccccatacgatatggactaagactg
aatatggatgaaaagtatacaggtttgaaaaagcagctgagtgatctctgtggacttaaa
tcagaacaaatcctttttgcagaagtgcatagttcaaacataaagaacttccctcaggac
aaccaaaaagttcgactctcagtgagtggatttttgtgtgcatttgaaattcctattcct
gcatctccagtttcagcttgcagtccaattcaaacagattgctcttcttctccatctaca
aatggactgtttaccttgactaccaatggggatctgcctcgacctatattcatccccaat
ggaatgccaaatacagttgtaccatgtggaactgagaagaatgtcacaaatggaatagtg
aatggtcatatgccgcctcttcctgatgacccctttacaggctacatcattgcagtccac
cgaaaaatgatgaggacagaactgtatttcctgtcatctcagaagaatcgccccagtctc
tttgggatgccactgattgttccatgtactgtacatacccggaaaaaagatctctatgat
gcagtttggattcaagtatctcgattagccagtccgctcccacctcaagaagctagcaac
catgcacaggattgtgatgacagcatgggctatcaatatccattcactctccgagttgtg
cagaaagatggaaactcctgtgcctggtgtccatggtatagattttgcagaggctgtaaa
atcgattgtggagaagacagagctttcattggaaatgcctgtattgctgtggattgggac
cctacagcccttcacctccgctatcaaacatcacaggaaagagttgtagaggagcatgaa
agtgtggaacagagtcggcgagcacaagctgagcccatcaacctggacagctgtctccgt
gccttcaccagtgaggaggaactgggggaaaatgagatgtactactgctccaaatgtaaa
acacactgtttggcaaccaagaaactggacctctggaggcttcctccaatcctgattatt
caccttaaacgatttcagtttgtaaatggacggtggataaaatcacagaaaattgttaaa
tttcctcgtgaaagttttgaccctagtgcttttttagtaccaagagacccaactctttgc
cagcataaaccactcacaccccagggggatgacttctctgagctaaggatcccagcagga
gatgtgaagaaagtggatatccagagctcagcaggggaggaggatgtgctcctgagcaag
agcccatcttcactcagtgcaaatgtcaccagtagcccaaaaggttcaccttcttcatca
agaaaaagtggagccagctgtccctccagcaaaaatagcagccctaacagcagcccacgg
accttggggaggaacaaagggaggctccggctgcctcaaattggcagcaaaaataaattg
tccaatagtaaggagaatttggataccagcaaagagaatggggctgggcagatctgtgaa
ctggctgacaccttgaaccgaagacatgtattgggaggcagccagcctgagctggtcact
cctctggatcatgagatcactttggctaatggatttctttatgagcatgaggcatgtggc
aatggctatagcaatggtcagcttggaaaccatagtgaagaagacagcactgatgaccaa
agagaagaaacacacagtaaacctatttataatctatatgcaatttcgtgccattcagga
attctgggtgggggccattacgtcacttatgccaaaaacccaaactgcaagtggtactgt
tacaatgacagcagctgtaaggagcttcaccctgatgagatagacaccgactctgcctac
attcttttctatgagcagcaggggatagactgtgcacagtttctgccaaagacagacggc
aagaagatggcggacacgagcagcatggacgaagactttgagtctgactacaagaagtac
tgtgtgctacagtaa

DBGET integrated database retrieval system