KEGG   Mus musculus (mouse): 23796Help
Entry
23796             CDS       T01002                                 

Gene name
Aplnr, APJ, Agtrl1, msr/apj
Definition
(RefSeq) apelin receptor
  KO
K04174  
apelin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    23796 (Aplnr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Gut peptide
   Apelin
    23796 (Aplnr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 E1
AA seq 377 aa AA seqDB search
MEDDGYNYYGADNQSECDYADWKPSGALIPAIYMLVFLLGTTGNGLVLWTVFRTSREKRR
SADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTG
LSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDASENGTKIQCY
MDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFTIMLTCYFFIAQTIAGHFRKERIEGLRK
RRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGSLLHWPCDFDIFLMNVFPYCTCISYVNS
CLNPFLYAFFDPRFRQACTSMLCCDQSGCKGTPHSSSAEKSASYSSGHSQGPGPNMGKGG
EQMHEKSIPYSQETLVD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaagatgatggttacaactactatggggctgacaaccagtctgaatgcgactacgca
gactggaagccctctggagcgctcattcctgccatctacatgttggtttttcttctaggc
accacaggcaatggcctggtgctctggaccgtgtttcgaaccagccgcgaaaagagacgc
tcagctgacatcttcattgccagcctggcagtggctgacttgacctttgtggtgactttg
ccactgtgggccacttatacctaccgggagtttgactggccttttggaaccttctcttgc
aagctcagcagctacctcatctttgtcaacatgtacgccagtgtcttttgcctcaccggc
ctcagctttgaccgatacctggccattgtcaggccggtggccaatgctcggctaaggctg
cgagtcagcggggccgtggccacagcagtcttatgggtgctggctgcccttctagctgtg
cctgtcatggtgttccgttccacagacgcctcggaaaatggcaccaagatccagtgctac
atggactactctatggtggccacttcaaactcagagtgggcctgggaggtgggccttggg
gtgtcctccactgccgtgggctttgtggtgcccttcaccatcatgctgacatgttacttc
ttcattgcccaaaccatcgctggccatttccgaaaggagcgcattgagggcctgcggaag
aggcgccggctgctcagcattatcgtggtgcttgtagtgacctttgccctgtgctggatg
ccttaccacctggtgaagactctctacatgctgggcagtttgctgcactggccctgtgac
tttgacatcttcctcatgaatgtctttccgtactgcacctgcatcagttatgtcaacagc
tgcctcaacccctttctctatgccttctttgacccccgatttcgccaagcctgcacctcc
atgctctgctgtgatcagagcgggtgcaaaggcacccctcacagcagtagtgctgagaag
tcagccagttattcttccgggcacagccagggccctggccccaacatgggaaagggagga
gagcagatgcatgagaaatcgattccctatagtcaagaaacccttgtggactag

DBGET integrated database retrieval system