KEGG   Mus musculus (mouse): 23797Help
Entry
23797             CDS       T01002                                 

Gene name
Akt3, AI851531, D930002M15Rik, Nmf350
Definition
(RefSeq) thymoma viral proto-oncogene 3 (EC:2.7.11.1)
  KO
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
Platinum drug resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Longevity regulating pathway
Longevity regulating pathway - multiple species
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Glucagon signaling pathway
Regulation of lipolysis in adipocytes
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
AGE-RAGE signaling pathway in diabetic complications
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Central carbon metabolism in cancer
Choline metabolism in cancer
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    23797 (Akt3)
   04015 Rap1 signaling pathway
    23797 (Akt3)
   04010 MAPK signaling pathway
    23797 (Akt3)
   04012 ErbB signaling pathway
    23797 (Akt3)
   04370 VEGF signaling pathway
    23797 (Akt3)
   04630 Jak-STAT signaling pathway
    23797 (Akt3)
   04668 TNF signaling pathway
    23797 (Akt3)
   04066 HIF-1 signaling pathway
    23797 (Akt3)
   04068 FoxO signaling pathway
    23797 (Akt3)
   04072 Phospholipase D signaling pathway
    23797 (Akt3)
   04071 Sphingolipid signaling pathway
    23797 (Akt3)
   04024 cAMP signaling pathway
    23797 (Akt3)
   04022 cGMP - PKG signaling pathway
    23797 (Akt3)
   04151 PI3K-Akt signaling pathway
    23797 (Akt3)
   04152 AMPK signaling pathway
    23797 (Akt3)
   04150 mTOR signaling pathway
    23797 (Akt3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    23797 (Akt3)
  Cellular community
   04510 Focal adhesion
    23797 (Akt3)
   04530 Tight junction
    23797 (Akt3)
   04550 Signaling pathways regulating pluripotency of stem cells
    23797 (Akt3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    23797 (Akt3)
   04620 Toll-like receptor signaling pathway
    23797 (Akt3)
   04660 T cell receptor signaling pathway
    23797 (Akt3)
   04662 B cell receptor signaling pathway
    23797 (Akt3)
   04664 Fc epsilon RI signaling pathway
    23797 (Akt3)
   04666 Fc gamma R-mediated phagocytosis
    23797 (Akt3)
   04062 Chemokine signaling pathway
    23797 (Akt3)
  Endocrine system
   04910 Insulin signaling pathway
    23797 (Akt3)
   04922 Glucagon signaling pathway
    23797 (Akt3)
   04923 Regulation of lipolysis in adipocyte
    23797 (Akt3)
   04920 Adipocytokine signaling pathway
    23797 (Akt3)
   04915 Estrogen signaling pathway
    23797 (Akt3)
   04914 Progesterone-mediated oocyte maturation
    23797 (Akt3)
   04917 Prolactin signaling pathway
    23797 (Akt3)
   04919 Thyroid hormone signaling pathway
    23797 (Akt3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    23797 (Akt3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    23797 (Akt3)
  Nervous system
   04725 Cholinergic synapse
    23797 (Akt3)
   04728 Dopaminergic synapse
    23797 (Akt3)
   04722 Neurotrophin signaling pathway
    23797 (Akt3)
  Development
   04380 Osteoclast differentiation
    23797 (Akt3)
  Aging
   04211 Longevity regulating pathway - mammal
    23797 (Akt3)
   04213 Longevity regulating pathway - multiple species
    23797 (Akt3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23797 (Akt3)
   05230 Central carbon metabolism in cancer
    23797 (Akt3)
   05231 Choline metabolism in cancer
    23797 (Akt3)
   05205 Proteoglycans in cancer
    23797 (Akt3)
   05210 Colorectal cancer
    23797 (Akt3)
   05212 Pancreatic cancer
    23797 (Akt3)
   05214 Glioma
    23797 (Akt3)
   05221 Acute myeloid leukemia
    23797 (Akt3)
   05220 Chronic myeloid leukemia
    23797 (Akt3)
   05218 Melanoma
    23797 (Akt3)
   05211 Renal cell carcinoma
    23797 (Akt3)
   05215 Prostate cancer
    23797 (Akt3)
   05213 Endometrial cancer
    23797 (Akt3)
   05224 Breast cancer
    23797 (Akt3)
   05222 Small cell lung cancer
    23797 (Akt3)
   05223 Non-small cell lung cancer
    23797 (Akt3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    23797 (Akt3)
   04931 Insulin resistance
    23797 (Akt3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    23797 (Akt3)
  Infectious diseases
   05152 Tuberculosis
    23797 (Akt3)
   05166 HTLV-I infection
    23797 (Akt3)
   05162 Measles
    23797 (Akt3)
   05164 Influenza A
    23797 (Akt3)
   05161 Hepatitis B
    23797 (Akt3)
   05160 Hepatitis C
    23797 (Akt3)
   05169 Epstein-Barr virus infection
    23797 (Akt3)
   05145 Toxoplasmosis
    23797 (Akt3)
   05142 Chagas disease (American trypanosomiasis)
    23797 (Akt3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    23797 (Akt3)
   01522 Endocrine resistance
    23797 (Akt3)
   01524 Platinum drug resistance
    23797 (Akt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23797 (Akt3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  AKT/PKB family
   23797 (Akt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 H4-H6
AA seq 479 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggctataaggag
aaacctcaagatgtggacttaccttatcccctcaacaacttctcagtggcaaaatgtcag
ttaatgaaaacagaacgaccaaagccaaatacatttattatcagatgtcttcagtggacc
actgttatagagagaacatttcatgtagatacaccagaggaaagagaagagtggacggaa
gctatccaagccgtagccgaccgattgcagaggcaagaggaggagaggatgaattgtagc
ccaacctcacagattgataatataggagaagaagagatggatgcgtctacaacccatcat
aaaagaaagacgatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactcttactgaaagcagagtacta
aagaacaccagacatccatttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatggcggagagctgtttttccatttgtcgagagag
cgagtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgctttggac
tatctacattctggaaagattgtgtaccgtgatctcaagttggagaatttgatgctagat
aaggatggccatataaaaattacggattttgggctttgcaaagaagggatcacagatgca
gctaccatgaagacattctgtggcacaccagagtacctggcaccagaggtattagaagat
aatgactatggccgagccgtggactggtggggcttaggtgttgtcatgtatgaaatgatg
tgtggaaggttgcctttctacaaccaggatcatgagaaactctttgaattaatactaatg
gaagacattaaattcccccgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggagggccagatgatgcaaaagaaatcatg
aggcatagttttttttctggagtaaactggcaagatgtatatgacaaaaagcttgtacct
ccttttaagcctcaagtaacatctgaaacagacacccgatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaagtatgacgacgacggcatggacggcatg
gacaacgagcggcggccacacttccctcagttctcctactctgcaagcggacgggaataa

DBGET integrated database retrieval system