KEGG   Mus musculus (mouse): 238023Help
Entry
238023            CDS       T01002                                 

Gene name
Hexdc, BC069960
Definition
hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing (EC:3.2.1.52)
Orthology
K14459  
hexosaminidase [EC:3.2.1.52]
Organism
mmu  Mus musculus (mouse)
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    238023 (Hexdc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     238023 (Hexdc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E2; 11
AA seq 486 aa AA seqDB search
MSSPTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRA
KHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVALFPNTLNPHEA
ESLALVQAMIDQILELHRDVRWLHIGCDEVYYLGEGETSKQWLQQEQNSHAKLCLSHMQA
VASHVLTQHPGVTPLVWDDMLRDIPQEQLKASGVPQLVEPVLWDYGADLDVHGKVFLIGK
YQECGFQRLWAASAFKGATGASQALPPVEHHIRNHELWLQVAGSGPKDALQGIILTGWQR
YDHFSVLCELLPVGIPSLAACLQSLVHGGFAEDVRLRAERFLGVSSLEIADTVSEGAGSF
PGSDIHALVTQISLHLRSSVDTLLERNRYVTGWFSPYHRRRKLVHPVMIQHIQPEALSLL
SRWNNLVQQLEVALQPVFYPDTIEEWLEENVLPSLQRLQDLLQDLGEAAARQPPPTSPGW
DTGQNP
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcacccacgccatttaagatgagattagttcatttggaccttaaaggagcgccg
ccaaaggtttcatatctctctgaggtttttcccttgttccatgcacttggtgcaaatggc
ctcctcattgagtacgaagacatgtttccctatgagggccacctgaggctgctgagggcc
aagcatgcatacagcccgtccgaggttacagagatcctgcgcctggccagactcagtgag
ctggaagttatccccttggtgcagacattcggacacatggagtttgtgctaaagcatgca
gcatttgcacatctccgtgaagtggctctcttccccaacaccctgaaccctcacgaggct
gagtccctggccttggtacaagctatgatcgatcaaattctggagctacacagggatgtc
cggtggctccacattggctgtgacgaggtctactacttgggtgagggggaaacctcaaaa
cagtggctacagcaggaacagaacagccatgcgaaattgtgcctgagccacatgcaggca
gtagccagccatgtgctgacccagcaccctggcgtaacacccttggtgtgggatgacatg
ctacgggacatccctcaggaacagctaaaagcatctggggtgcctcaactggtggagcct
gtcctctgggactatggagctgacctggatgtccatggcaaagttttcctcataggaaag
taccaggagtgtggcttccagaggctgtgggctgccagtgccttcaagggggccacagga
gctagtcaggctctgccccctgttgagcaccacatcagaaaccatgagctgtggctgcag
gtggcaggcagtggaccaaaggatgctctacaaggaatcatcctgacgggctggcagagg
tacgaccacttctctgtgctgtgtgagctgcttccggtggggatcccatccctggctgcc
tgcctacagtcacttgtacatggaggctttgctgaggatgttaggctgagagcggaacgc
ttccttggggtttcaagcctggagatagcggatactgtaagtgagggagctggctccttc
cctggcagtgacatccatgccctcgtcacacaaattagtctccacctgcgcagctctgtg
gacacacttctggaaaggaacaggtatgtcactggctggttcagcccctaccatcgtaga
cggaagcttgttcacccagttatgatccagcacatacagccggaggcactcagccttcta
agtaggtggaacaacctcgtgcagcagttggaggtggccctgcagccggtcttctacccg
gacaccatagaggagtggctggaggagaatgtgctcccgagtctgcagcgactgcaggat
ctgctgcaggacctgggtgaggcggctgcccgacagccaccacccaccagcccaggctgg
gacacagggcagaacccctga

DBGET integrated database retrieval system