KEGG   Mus musculus (mouse): 23821Help
Entry
23821             CDS       T01002                                 

Gene name
Bace1, ASP2, Bace, C76936
Definition
(RefSeq) beta-site APP cleaving enzyme 1 (EC:3.4.23.46)
  KO
K04521  
beta-site APP-cleaving enzyme 1 (memapsin 2) [EC:3.4.23.46]
Organism
mmu  Mus musculus (mouse)
Pathway
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    23821 (Bace1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.46  memapsin 2
     23821 (Bace1)
Peptidases [BR:mmu01002]
 Aspartic Peptidases
  Family A1: pepsin family
   23821 (Bace1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9; 9 A5.2
AA seq 501 aa AA seqDB search
MAPALHWLLLWVGSGMLPAQGTHLGIRLPLRSGLAGPPLGLRLPRETDEESEEPGRRGSF
VEMVDNLRGKSGQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSST
YRDLRKGVYVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGIL
GLAYAEIARPDDSLEPFFDSLVKQTHIPNIFSLQLCGAGFPLNQTEALASVGGSMIIGGI
DHSLYTGSLWYTPIRREWYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKK
VFEAAVKSIKAASSTEKFPDGFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRIT
ILPQQYLRPVEDVATSQDDCYKFAVSQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSAC
HVHDEFRTAAVEGPFVTADMEDCGYNIPQTDESTLMTIAYVMAAICALFMLPLCLMVCQW
RCLRCLRHQHDDFADDISLLK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggccccagcgctgcactggctcctgctatgggtgggctcgggaatgctgcctgcccag
ggaacccatctcggcatccggctgccccttcgcagcggcctggcagggccacccctgggc
ctgaggctgccccgggagaccgacgaggaatcggaggagcctggccggagaggcagcttt
gtggagatggtggacaacctgaggggaaagtccggccagggctactatgtggagatgacc
gtaggcagccccccacagacgctcaacatcctggtggacacgggcagtagtaactttgca
gtgggggctgccccacaccctttcctgcatcgctactaccagaggcagctgtccagcaca
tatcgagacctccgaaagggtgtgtatgtgccctacacccagggcaagtgggagggggaa
ctgggcaccgacctggtgagcatccctcatggccccaacgtcactgtgcgtgccaacatt
gctgccatcactgaatcggacaagttcttcatcaatggttccaactgggagggcatccta
gggctggcctatgctgagattgccaggcccgacgactctttggagcccttctttgactcc
ctggtgaagcagacccacattcccaacatcttttccctgcagctctgtggcgctggcttc
cccctcaaccagaccgaggcactggcctcggtgggagggagcatgatcattggtggtatc
gaccactcgctatacacgggcagtctctggtacacacccatccggcgggagtggtattat
gaagtgatcattgtacgtgtggaaatcaatggtcaagatctcaagatggactgcaaggag
tacaactacgacaagagcattgtggacagtgggaccaccaaccttcgcttgcccaagaaa
gtatttgaagctgccgtcaagtccatcaaggcagcctcctcgacggagaagttcccggat
ggcttttggctaggggagcagctggtgtgctggcaagcaggcacgaccccttggaacatt
ttcccagtcatttcactttacctcatgggtgaagtcaccaatcagtccttccgcatcacc
atccttcctcagcaatacctacggccggtggaggacgtggccacgtcccaagacgactgt
tacaagttcgctgtctcacagtcatccacgggcactgttatgggagccgtcatcatggaa
ggtttctatgtcgtcttcgatcgagcccgaaagcgaattggctttgctgtcagcgcttgc
catgtgcacgatgagttcaggacggcggcagtggaaggtccgtttgttacggcagacatg
gaagactgtggctacaacattccccagacagatgagtcaacacttatgaccatagcctat
gtcatggcggccatctgcgccctcttcatgttgccactctgcctcatggtatgtcagtgg
cgctgcctgcgttgcctgcgccaccagcacgatgactttgctgatgacatctccctgctc
aagtaa

DBGET integrated database retrieval system