KEGG   Mus musculus (mouse): 23827Help
Entry
23827             CDS       T01002                                 

Gene name
Bpnt1, BPntase
Definition
bisphosphate 3'-nucleotidase 1 (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mmu  Mus musculus (mouse)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mmu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1; 1 H4
AA seq 308 aa AA seqDB search
MASSHTVLMRLVASAYSIAQKAGTIVRCVIAEGDLGIVQKTSATDLQTKADRLVQMSICS
SLARKFPKLTIIGEEDLPPGEVDQELIEDGQWEEILKQPCPSQYSAIKEEDLVVWVDPLD
GTKEYTEGLLDNVTVLIGIAYEGKAIAGIINQPYYNYQAGPDAALGRTIWGVLGLGAFGF
QLKEAPAGKHIITTTRSHSNQLVTDCISAMNPDTVLRVGGAGNKIIQLIEGKASAYVFAS
PGCKKWDTCAPEVILHAVGGKLTDIHGNALQYNKEVKHMNSAGVLAALRNYEYYASHVPE
SVKNALIP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagccacaccgtgttgatgcggctggtagcttcagcatattctatcgctcaa
aaggcaggaaccatagtcaggtgtgtcattgctgaaggagacctgggcatcgtgcagaag
acctcggccaccgacctgcagaccaaagccgaccgcttggtgcagatgagcatatgctct
tccctggcccggaagttcccgaagctgaccatcataggggaagaggacctgcctcctggg
gaagtggatcaagagctgattgaagacgggcagtgggaggagatcctgaagcagccgtgc
ccctcgcagtacagtgctatcaaggaggaagaccttgtggtttgggttgaccccttagat
ggcaccaaggagtacactgaaggtcttcttgacaatgtaacagttctcattgggattgct
tatgaaggaaaggccatcgcaggcatcatcaaccagccgtattacaactaccaggcagga
cccgacgcggcgctgggcaggaccatctggggagttctgggtttgggtgcttttgggttt
cagctgaaggaagcccctgccgggaagcacattatcacaaccaccagatcccatagcaac
cagctggtcacagactgcatttccgccatgaaccccgacaccgtgctgcgagtgggagga
gcaggaaacaagattatccagctgatcgaaggcaaagcttctgcttatgtgtttgcaagt
cctgggtgtaagaagtgggacacttgtgccccggaagttatcttgcatgctgtgggaggg
aagttgacagacatccatgggaatgccctgcagtacaacaaggaggtgaaacatatgaac
tctgccggtgtcctggctgcactgaggaactacgagtactatgcaagccatgttccagag
tcggtcaaaaatgcgctcattccatga

DBGET integrated database retrieval system