KEGG   Mus musculus (mouse): 23928Help
Entry
23928             CDS       T01002                                 

Gene name
Lamc3, AI562206, AW240805
Definition
laminin gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
mmu  Mus musculus (mouse)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    23928 (Lamc3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    23928 (Lamc3)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    23928 (Lamc3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    23928 (Lamc3)
   05222 Small cell lung cancer
    23928 (Lamc3)
  Infectious diseases
   05146 Amoebiasis
    23928 (Lamc3)
   05145 Toxoplasmosis
    23928 (Lamc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 B; 2
AA seq 1581 aa AA seqDB search
MAVSRVLSLLATVASMALVIQETHFAAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEAS
HTCGRPPEDFCPHVGAPGAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFG
VQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTY
GRPEGHYLRPGEDERVAFCTSEFSDISPLNGGNVAFSTLEGRPSAYNFEESPVLQEWVTS
TDILISLDRLNTFGDDIFKDPRVLQSYYYAVSDFSVGGRCKCNGHASECEPNAAGQLACR
CQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTGHGGH
CQRCRDHTTGPHCERCEKNYYRWSPKTPCQPCDCHPAGSLSLQCDNSGVCPCKPTVTGWK
CDRCLPGFHSLSEGGCRPCACNVAGSLGTCDPRSGNCPCKENVEGSLCDRCRPGTFNLQP
HNPVGCSSCFCYGHSKVCSPAAGFQEHHIRSDFRHGAGGWQIRSMGVSKRPLQWSQSGLL
LGLRGGEELSAPKKFLGDQRLSYGQPVILTLQVPPGGSPPPIQLRLEGAGLALSLRPSSL
PSPQDTRQPRRVQLQFLLQETSEEAESPLPTFHFQRLLSNLTALSIWTSGQGPGHSGQVL
LCEVQLTSAWPQRELAPPASWVETCLCPQGYTGQFCEFCALGYKREIPHGGPYANCIPCT
CNQHGTCDPNTGICLCGHHTEGPSCERCMPGFYGNAFSGRADDCQPCPCPGQSACATIPE
SGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQPCRRCQCSGNVDLNAVGNCDPHS
GHCLRCLYNTTGAHCEHCREGFYGSAVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVC
LPYVSGRDCSRCSPGFYDLQSGRGCQSCKCHPLGSLENKCHPKTGQCPCRPGVTGQACDR
CQLGFFGFSIKGCRDCRCSPLGAASSQCHENSTCVCRPGFVGYKCDRCQDNFFLADGDTG
CQECPTCYALVKEEAAKLKARLMLMEGWLQRSDCGSPWGPLDILQGEAPLGDVYQGHHLL
QETRGTFLQQMVGLEDSVKATWEQLQVLRGHVHCAQAGAQKTCIQLAELEETLQSSEEEV
LRAASALSFLASLQKGSSTPTNWSHLASEAQILARSHRDTATKIEATSERALLASNASYE
LLKLMEGRVASEAQQELEDRYQEVQAAQTALGIAVAEALPKAEKALATVKQVIGDAAPHL
GLLVTPEAMNFQARGLSWKVKALEQKLEQKEPEVGQSVGALQVEAGRALEKMEPFMQLRN
KTTAAFTRASSAVQAAKVTVIGAETLLADLEGMKLRSPLPKEQAALKKKAGSIRTRLLED
TKRKTKQAERMLGNAASLSSSTKKKSKEAELMSKDNAKLSRALLREGKQGYRHASRLASQ
TQATLRRASRLLLTSEAHKQELEEAKQVTSGLSTVERQIRESRISLEKDTKVLSELLVKL
GSLGVHQAPAQTLNETQRALESLRLQLDSHGALHHKLRQLEEESARQELQIQSFEDDLAE
IRADKHNLETILSSLPENCAS
NT seq 4746 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatccagggtcctgtccctcctggcaacggtggcatcgatggcgctggtgatt
caggagacacacttcgcggcaggcgcggacatgggctcttgctacgacggtgtgggacgc
gcacagcgctgtctgcctgagttcgagaacgcggcgttcggccgacgcgccgaggcctcc
cacacgtgcggacggcccccggaggacttctgtccacacgtgggggcaccaggggctggg
ctacagtgccagcgctgcgacgatgctgaccccggacgacgccacgacgcctcctacctc
acagacttccacagccccgatgacagcacctggtggcagagcccatccatggccttcggg
gtgcagtaccccacctctgttaacctgaccttgagcttagggaaggcctatgagattacc
tatgtgaggctgaagttccacaccagtcgccctgagagttttgccatctacaagcgcacg
tacgccagtggcccctgggagccctaccaatactacagtgcctcctgccagaaaacctat
ggccgtcctgagggccactacctgcgaccgggcgaggatgagagggtggccttctgcacc
tctgagttcagtgacatctcccccttgaacgggggcaacgtggccttctccaccctggaa
ggccgtcccagtgcctacaactttgaggagagccctgtgctgcaggagtgggtcaccagc
actgacatcctgatctctctagatcggctcaacacgtttggggatgacatcttcaaggac
cccagagtgctccagtcttactactacgctgtgtctgacttctctgtgggtggcaggtgc
aaatgcaatggtcacgccagtgaatgcgaacccaatgcggctggtcagctggcttgccgc
tgtcagcacaacaccacaggagtggactgcgagcgttgtctgcccttcttccaggaccgt
ccgtgggcccgaggcaccgccgaggatgccaacgagtgtctgccctgcaactgcagtggg
cactctgaggagtgcacgtttgacagggagctctatcggagcacaggccatggtgggcac
tgtcagcggtgccgtgaccacacaactgggccacactgtgagcgctgtgagaagaactac
tacagatggtccccgaagacaccatgccaaccctgtgactgccacccagcaggctctctg
agtctccagtgtgacaactcaggcgtctgtccctgcaagcccacagtgacaggctggaag
tgtgatcgctgcctgcctggattccactcactcagtgagggcggctgcagaccctgtgcc
tgcaatgtcgccggcagcttgggcacctgtgacccccgcagtgggaactgtccctgcaaa
gagaatgtagaaggcagcctgtgtgacagatgccgccctgggacatttaacctgcagccc
cacaatccagtgggctgcagcagctgcttctgttatggccactccaaggtgtgttctcct
gctgccgggttccaggaacaccacatccgctcagacttccgccatggagctggtggctgg
cagatcagaagcatgggagtgtccaagcgtcctctgcaatggagccagagtgggctcctc
ctgggcctgcgaggaggggaggaactctcagccccaaagaagttcctgggagaccagaga
ctcagctatggacagccagtcatactgaccctccaagtaccccctggaggctccccacct
cctattcagctgagactggagggagcaggcttggctctgtctctgaggccctccagtcta
cccagccctcaggacaccaggcagccaagacgagttcagctccagttcctcttgcaggag
acttctgaggaggcagagtccccactgcccaccttccacttccagcgcctgctttccaat
ctgactgctctgagcatctggaccagtggccaaggaccgggccattctggccaagtgctc
ttgtgtgaagttcagctcacatcggcctggccccagcgtgagcttgcccctccagcctct
tgggtggagacctgcttatgtccccagggatacacaggccagttctgtgaattctgtgct
ctgggatacaagagagaaatacctcatgggggtccctatgccaactgcattccctgcacc
tgcaaccagcatggcacctgtgaccccaacacagggatctgcctgtgtggccaccacacc
gagggtccatcctgtgagcggtgcatgccaggtttctacggtaacgccttctcaggccgt
gctgatgattgccagccctgtccgtgccctggccaatcagcctgtgcaaccatcccagag
agtggagatgtggtgtgcacacactgccctcctggtcagagaggacgacgatgcgagagc
tgcgaagatggcttttttggggatcctctagggctctctggagctccccagccctgccgc
cgatgccagtgcagcgggaacgtggatctcaatgctgtgggcaactgtgatcctcattct
ggccactgcttgcgctgtctgtacaacacgacaggggcccactgcgagcactgtcgggag
ggtttctacgggagtgccgtggccacaaggcccgtggacaaatgtgctccctgcagctgt
gacctgaggggctcagtcagtgagaagacctgcaaccctgtgactggccagtgtgtctgc
ctgccttatgtctccgggagggactgcagccgctgcagccctggcttctatgacctccag
tctgggaggggctgccagagctgcaaatgtcacccacttggatccttggagaataagtgc
caccccaagactggccagtgtccctgccgacctggtgtcactggccaagcctgtgacaga
tgccagctaggtttctttggcttctccatcaagggctgccgagactgtaggtgctcccca
ttgggtgctgcctcatctcagtgccatgagaacagcacctgtgtgtgccggcccggcttt
gtgggctataaatgcgaccgctgccaggacaatttcttcctcgcggatggcgacacaggc
tgccaagagtgtcccacttgctatgccctagtgaaggaagaggcagccaagctgaaggcc
aggttgatgctgatggaggggtggcttcaaaggtctgactgtggtagcccctggggacca
ctagacattctgcagggagaagcccctctgggggatgtctaccaaggtcaccacctactt
caagagacccgggggaccttcctgcagcagatggtgggcctggaggattctgtgaaggcc
acttgggagcagttgcaggtgctgagagggcatgtacactgtgcccaggctggagctcag
aagacctgcatccagctggcagagctggaggagacattgcagtcctcagaggaggaggtc
cttcgtgcagcctcagctctctcatttctggcaagtcttcagaaaggatccagcacaccc
accaattggagtcacctggcatcagaggcccagatccttgccagaagccacagggacacg
gccaccaagatcgaagctacctcggaaagggccctgctcgcctccaacgccagctatgag
ctcctgaagctgatggaaggcagagtggcctcggaagcccagcaggaactggaggacagg
taccaggaggtgcaggcagctcagactgccctgggcatagctgtggcagaggcgctgccc
aaagctgaaaaggcactggccacggtgaagcaagtcattggtgacgcagccccacatcta
ggcttgctggtcacccctgaagcaatgaacttccaagccaggggcctgagctggaaagtg
aaggccctggagcagaagctggagcagaaggagcccgaggtgggccagtctgtgggagcc
ctgcaggtggaggctggaagagccttggagaagatggagccctttatgcagctacgcaat
aagaccacagctgccttcacacgggcttcctcagctgtgcaagctgccaaggtgaccgtc
ataggagcagagaccctgctagctgacctagagggaatgaagctgaggtctcctctaccc
aaggagcaggcagcgctgaagaagaaagcaggcagcatcaggaccaggctcctggaggac
acaaagaggaagaccaagcaggcagagaggatgctgggaaatgctgcctctctctcctcc
agcaccaagaagaaaagcaaagaagcagaactgatgtctaaggacaatgccaagctctcc
agagctttgctgagggaaggcaagcagggctaccgtcatgccagccgactcgccagccag
acccaggccacactccgtcgggcctctcgcctgctgctgacctcagaagcacacaagcag
gagctggaggaagctaaacaggtgacctctgggctgagcactgtggagcgccagatccga
gagtctcggatctccttggagaaggacaccaaggtcctgtcagagctgcttgtgaagctg
gggtccctgggtgtccaccaagcccctgctcagaccctgaacgagacccagcgggcacta
gaaagcttgaggctgcagctggattcccacggagccctgcatcacaaactgaggcagctg
gaggaagagtctgctcgacaggagctgcagattcagagctttgaggacgaccttgctgag
atccgcgctgacaagcacaacttggagaccattctgagcagtctgccagagaactgtgcc
agctag

DBGET integrated database retrieval system