KEGG   Mus musculus (mouse): 23938Help
Entry
23938             CDS       T01002                                 

Gene name
Map2k5, AI324775, AI428457, MEK5, Mapkk5, Prkmk5
Definition
(RefSeq) mitogen-activated protein kinase kinase 5 (EC:2.7.12.2)
  KO
K04463  
mitogen-activated protein kinase kinase 5 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
Oxytocin signaling pathway
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    23938 (Map2k5)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    23938 (Map2k5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    23938 (Map2k5)
  Nervous system
   04722 Neurotrophin signaling pathway
    23938 (Map2k5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     23938 (Map2k5)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   23938 (Map2k5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
9; 9 C
AA seq 448 aa AA seqDB search
MLWLALGPFCAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAF
EYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL
KVNTRAGPSQHTSPVVSDSLPSNSLKKSSAELRKILANGQMNEQDIRYRDTLGHGNGGTV
YKAHHVPSGKILAVKVILLDITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC
TEFMDGGSLDVYRKIPEHVLGRIAVAVVKGLTYLWSLKILHRDVKPSNMLVNTGGQVKLC
DFGVSTQLVNSIAKTYVGTNAYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ
KNQGSLMPLQLLQCIVDEDSPVLPLGEFSEPFVHFITQCMRKQPKERPAPEELMGHPFIV
QFNDGNSTVVSMWVCRALEERRSQQGPP
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggctggcccttggccccttctgtgccatggagaaccaggtgctggtgattcgg
atcaagattccaaatagtggcgcggtggactggaccgtgcactccgggccgcagttactc
ttcagggatgttctggatgtgataggccaggttctgcctgaagcgacgacgacagcgttt
gaatatgaagatgaagatggtgataggattacagtaagaagcgatgaagagatgaaggca
atgctgtcctactattattccacagtaatggaacagcaagtaaatggccagctaatagag
ccgctgcagatatttccaagagcctgcaagcctcctggggaacggaacatacatggcctg
aaggtgaatacacgggctgggccatctcaacacaccagccctgtggtctcagattcgctt
ccaagcaatagcttgaagaagtcctcagctgaactgagaaagatactggccaacggccag
atgaatgaacaagacatacggtatcgagacacccttggtcatggcaacggaggcacagtc
tacaaagcacatcatgtcccaagtgggaaaattttagctgtaaaggttattctgttagac
attacactggagcttcagaagcagatcatgtctgagctggaaatcctttataagtgtgac
tcatcgtatatcataggattttacggggcatttttcgtagaaaacaggatttcaatttgt
acagaattcatggatggggggtctttggatgtatataggaaaattccagagcacgtcctt
ggaagaattgcagttgcagttgttaaaggccttacctatctgtggagtttaaagatttta
cacagagatgtgaagccctccaacatgcttgtaaacacaggcggacaggtcaagctgtgt
gactttggcgtgagcacacagctggtgaattctatagccaagacgtatgttggaacaaat
gcttacatggcaccagaaagaatttcaggagagcagtatgggatccattctgacgtgtgg
agcttaggaatctctttcatggagcttgctcttgggaggtttccatatcctcagattcag
aaaaaccagggatctttaatgcctctccagcttctgcagtgcattgttgatgaggattcg
ccggtccttccgcttggagagttctcggagccgtttgtacatttcatcactcagtgcatg
aggaagcagcccaaggagagaccggcgcctgaggagctgatgggtcacccattcatcgtg
cagttcaatgatggaaactccactgtggtgtccatgtgggtgtgccgagctctagaggag
aggcggagccagcagggacccccgtga

DBGET integrated database retrieval system