KEGG   Mus musculus (mouse): 23939Help
Entry
23939             CDS       T01002                                 

Gene name
Mapk7, BMK-1, BMK1, ERK-5, ERK5, Erk5-T, PRKM7
Definition
mitogen-activated protein kinase 7 (EC:2.7.11.24)
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    23939 (Mapk7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    23939 (Mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    23939 (Mapk7)
   04921 Oxytocin signaling pathway
    23939 (Mapk7)
  Nervous system
   04722 Neurotrophin signaling pathway
    23939 (Mapk7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    23939 (Mapk7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     23939 (Mapk7)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   23939 (Mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B2; 11
AA seq 737 aa AA seqDB search
MCGLLSRGGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDILKPTVPYGE
FRSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLL
VNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVG
CIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQSLPPRQPVPW
ETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCAPPFDFAFDR
EALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPVCPDVEMPSPWAPSGDC
AMESPPPALPPCSDPAPDTVDLTLQPAPPASELAPPKREGAISDNTKAALKAALLKSLRS
RLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERERKERGAGTLG
GPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPAPAPAPAPAPSSAQPTSTPTGPVSQS
TGPLQPAGSIPGPASQPVCPPPGPVPQPAGPIPAPLQTAPSTSLLASQSLVPPSGLPGSG
APEVLPYFPSGPPPPDPGLTPQPSTSESPDVNLVTQQLSKSQVEDPLPPVFSGTPKGSGA
GYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWLEGHGMNPADIESLQREI
QMDSPMLLSDLPDLQEP
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggactgctttccagaggcggccagcaggtggccatcaagaagatacctaatgct
tttgatgtggtgaccaatgccaaacggaccctcagggagctgaagatcctcaaacacttc
aaacacgacaatatcatcgccatcaaggacatcctgaagcctactgtgccctatggagaa
ttcagatctgtctatgtggtactggacctcatggagagcgacctacaccagatcattcac
tcttcacagccgctcaccctggaacatgtgagatacttcctgtaccagctgcttcggggc
ctcaaatacatgcactctgctcaggtcatccaccgtgatcttaaaccctctaaccttctg
gtcaatgagaactgtgagctcaagatcggtgactttggaatggcccgtggcctctgtact
tcccctgccgagcaccagtacttcatgactgagtatgtggctactcgctggtaccgtgcc
ccggagctcatgctttccctgcacgagtatacgcaggcaatcgacctctggtctgtgggc
tgcatctttggtgagatgctggctcggcgccagctcttcccaggcaaaaactacgtgcac
cagttacagctgatcatgatggtgttgggaactccgtcaccagctgtgattcaggctgtg
ggggctgaaagggtgcgagcctatatccagagcctgccaccaaggcaacctgtgccttgg
gagacagtatacccaggtgctgaccgccaggccctctccctgctgggacgcatgttgcga
tttgaacccagtgcccgaatctcagctgctgctgcccttcgccaccccttcctggctaag
taccatgaccctgatgatgagcctgattgcgccccaccttttgactttgcttttgaccgt
gaagcccttaccagggagcgcattaaggaggccattgtggctgagattgaggacttccat
gcacgacgggagggcatccgccaacaaatccgcttccagccttctctgcagcctgtggct
agtgagcctgtgtgtccagatgttgagatgcccagtccctgggctccaagtggagactgt
gccatggagtcgcctcctccagcactgccaccatgctctgatcctgcacctgacaccgtt
gatctgactctgcagcctgccccgccggccagtgagcttgctccaccaaaaagagagggt
gccatctccgacaataccaaagcagccctcaaagctgccctgctcaagtccctaaggagc
aggctcagagatgggcccagtgcacccttggaggcgcctgagcctcgaaagcccgtgaca
gctcaggaacgccagcgagaacgagaagagaagcgcaggaggcgacaagagagagccaag
gagcgggagaagcgacgacaagagagagaacgcaaggagaggggggctggtaccttgggg
ggcccctctactgaccctctggctggactggtgctcagtgacaatgaccgaagcctgcta
gagcggtggactcgcatggctaggcctcctgcccctgcccctgccccagcgccagcacca
gcgccagcaccgtcctctgcccagcccactagtactcctactggccccgtatctcagtct
actggtcctctacagcctgcaggctctattccgggtcctgcctcccagcctgtttgccca
ccccctggccctgttccccagcctgctggccctatccctgctccgctccagactgcccct
tccactagccttttggcctcccagtcacttgtgccacctagtgggttgcctggttctggt
gccccagaagttctgccttacttcccatctggcccaccacctccagatcctgggctcacc
cctcagccttctacatcagagtcacctgatgtcaacctggtgactcagcagctgtccaag
tctcaggtggaggaccccctgcctcctgtgttctctggcactccaaagggcagtggggct
ggctacggagttggctttgatctggaggaattcttaaatcaatcttttgatatgggtgtg
gctgatgggccacaggatggccaggcagactcagcctcactctcagcctctctccttgct
gactggcttgagggccatggcatgaaccctgctgacattgagtctctgcagcgtgagatc
cagatggactccccaatgctgctgtctgacctgcctgacctccaagagccctga

DBGET integrated database retrieval system