KEGG   Mus musculus (mouse): 23945Help
Entry
23945             CDS       T01002                                 

Gene name
Mgll, AA589436, Magl, Mgl
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    23945 (Mgll)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    23945 (Mgll)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    23945 (Mgll)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     23945 (Mgll)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S33
   23945 (Mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6; 6 D1
AA seq 303 aa AA seqDB search
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaggcaagttcacccaggcgaactccacagaatgttccctaccaggacctgcct
cacctggtcaatgcagacggacagtacctcttttgtagatactggaagcccagtggcaca
cccaaggccctcatctttgtgtcccatggagctggggaacactgtggccgttatgatgag
ctggctcatatgttgaaggggctggacatgctggtatttgcccatgaccatgttggccat
gggcagagtgagggagagaggatggtggtgtcggacttccaagtttttgtcagagatgtg
ctgcaacacgtggacaccatccagaaggactaccccgacgtccccatcttcctcctgggc
cactccatgggcggtgccatctccatcctagtggctgcagagaggccaacctacttttct
ggcatggtcctgatttcacctctggtccttgccaatccggaatctgcatcgactttgaag
gtccttgctgccaaactgctcaattttgtcctgccaaatatgaccttggggcgcattgac
tccagcgtgctgtctcggaacaagtcggaggttgacctgtacaactctgacccactcgtc
tgccgagcagggctgaaggtgtgctttggcatacagctgctgaatgccgtcgcaagagtg
gagcgagcaatgcccaggctgacactgccattcctgctgctgcagggttctgctgaccgg
ctttgcgacagcaaaggtgcctacctgctcatggaatcatcccggagtcaggacaaaaca
ctcaagatgtatgaaggtgcctatcacgtcctccacagggagcttccggaagtgaccaac
tccgtcctccatgaagtaaactcgtgggtgtctcacaggatagcagcagcaggagctggg
tgtccaccctga

DBGET integrated database retrieval system