KEGG   Mus musculus (mouse): 23968Help
Entry
23968             CDS       T01002                                 

Gene name
Nlrp5, Mater, Nalp5, Op1, PAN11
Definition
(RefSeq) NLR family, pyrin domain containing 5
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 10.22 cM; 7 A2
AA seq 1111 aa AA seqDB search
MGPPEKESKAILKARGLEEEQKSERKMTSPENDSKSIQKDQGPEQEQTSESTMGPPEKDS
KAILKARGLEEEQKSESTMSPSENVSRAILKDSGSEEVEQASERKMTSPENDSKSIQKDQ
GPEQEQTSETLQSKEEDEVTEADKDNGGDLQDYKAHVIAKFDTSVDLHYDSPEMKLLSDA
FKPYQKTFQPHTIILHGRPGVGKSALARSIVLGWAQGKLFQKMSFVIFFSVREIKWTEKS
SLAQLIAKECPDSWDLVTKIMSQPERLLFVIDGLDDMDSVLQHDDMTLSRDWKDEQPIYI
LMYSLLRKALLPQSFLIITTRNTGLEKLKSMVVSPLYILVEGLSASRRSQLVLENISNES
DRIQVFHSLIENHQLFDQCQAPSVCSLVCEALQLQKKLGKRCTLPCQTLTGLYATLVFHQ
LTLKRPSQSALSQEEQITLVGLCMMAAEGVWTMRSVFYDDDLKNYSLKESEILALFHMNI
LLQVGHNSEQCYVFSHLSLQDFFAALYYVLEGLEEWNQHFCFIENQRSIMEVKRTDDTRL
LGMKRFLFGLMNKDILKTLEVLFEYPVIPTVEQKLQHWVSLIAQQVNGTSPMDTLDAFYC
LFESQDEEFVGGALKRFQEVWLLINQKMDLKVSSYCLKHCQNLKAIRVDIRDLLSVDNTL
ELCPVVTVQETQCKPLLMEWWGNFCSVLGSLRNLKELDLGDSILSQRAMKILCLELRNQS
CRIQKLTFKSAEVVSGLKHLWKLLFSNQNLKYLNLGNTPMKDDDMKLACEALKHPKCSVE
TLRLDSCELTIIGYEMISTLLISTTRLKCLSLAKNRVGVKSMISLGNALSSSMCLLQKLI
LDNCGLTPASCHLLVSALFSNQNLTHLCLSNNSLGTEGVQQLCQFLRNPECALQRLILNH
CNIVDDAYGFLAMRLANNTKLTHLSLTMNPVGDGAMKLLCEALKEPTCYLQELELVDCQL
TQNCCEDLACMITTTKHLKSLDLGNNALGDKGVITLCEGLKQSSSSLRRLGLGACKLTSN
CCEALSLAISCNPHLNSLNLVKNDFSTSGMLKLCSAFQCPVSNLGIIGLWKQEYYARVRR
QLEEVEFVKPHVVIDGDWYASDEDDRNWWKN
NT seq 3336 nt NT seq  +upstreamnt  +downstreamnt
atgggtcctccagaaaaagaaagtaaagcaatcttgaaagcacgtggattggaagaggaa
cagaagtcagaaagaaaaatgacttctccagaaaacgacagtaaatcaatccagaaagac
caaggaccagagcaggagcagacatcagaaagcacaatgggtcctccagaaaaagacagt
aaagcaatcttgaaagcacgtggattggaagaggaacagaagtcagaaagcacaatgtct
ccttcagaaaatgtcagtagagcaatcctgaaagacagtggatcagaagaagtggaacag
gcgtcagaaagaaaaatgacttctccagaaaacgacagtaaatcaatccagaaagaccaa
ggaccagagcaggagcagacatcagaaaccttacaatctaaggaagaagatgaagtgaca
gaggcagataaagataatggaggtgacttacaagactacaaggcccatgtgattgctaag
ttcgacacaagtgtggatctacactatgacagcccagagatgaaattattgtctgatgct
tttaaaccataccagaaaaccttccagcctcacaccattatcctacatggaagaccagga
gttgggaagtcagctttggccagaagtattgttcttggctgggcacagggtaaactcttc
caaaaaatgtcctttgtcatcttcttctctgttagagaaataaagtggacagagaagagc
agtttggcacagctgattgctaaggagtgtccagactcctgggatctagtgacaaagatc
atgtcccaaccagaaagactcttgtttgtcatagatggcttggatgatatggactctgtc
ctccaacatgatgatatgacactatccagagactggaaggatgaacagcccatatacatc
ctgatgtacagcctcctgaggaaggctctcctacctcagtcctttctcatcattaccacc
agaaacacaggcttagaaaaactcaagtcaatggttgtgtcccccctctatatactggtt
gaaggactgtctgcatcaaggagatctcagctggtcctcgagaacatctccaatgagtct
gatagaatacaagtcttccattctctgatagaaaatcaccagctgtttgaccaatgccag
gccccctctgtgtgctccctggtctgtgaggctctacagctacagaagaaactgggaaag
agatgcaccctaccctgccagactctcaccggtttgtatgccacgttggtgtttcaccag
ctcaccttgaaaaggccttcccagagcgctctcagtcaggaagaacagattactctagtg
ggtttgtgcatgatggcagctgaaggagtgtggaccatgaggtcggtgttctatgatgat
gacctgaagaactatagcctaaaggagtctgagatcttggccctctttcacatgaacatc
cttctccaggttggccacaacagtgagcagtgttatgttttctcccacctcagcctgcag
gatttctttgctgccttatattatgttttagaagggctggaggaatggaatcagcatttt
tgcttcattgaaaaccaaaggagcatcatggaggtgaagagaactgacgacactcgcctc
ctcgggatgaagcgtttcttatttggcctcatgaacaaggatatcttgaagactctggag
gttctgtttgaatatcccgtgattccaactgttgagcagaagctccaacactgggtctct
ctgatagctcagcaggtcaatggcaccagcccaatggacaccctggatgccttctattgt
ctatttgagtctcaggatgaagagtttgttggcggggctctcaaacgcttccaagaagtg
tggctgctgattaaccagaagatggacttgaaggtctcttcctactgtctcaagcactgt
cagaacttgaaggcaatccgggtggatatcagagacctcctctcggtagataatactctc
gagctgtgccctgttgttactgtccaggagacacaatgtaagcccctcctcatggagtgg
tggggaaacttctgctctgtgcttggcagcctccggaacttgaaggagctggacttgggc
gacagcatcctgagtcaacgggccatgaagatactgtgcctcgagctgcggaatcagtcc
tgcagaatacagaagctgacgtttaagagtgcagaggtagtgtctggcctgaaacatctc
tggaagctcctttttagcaatcaaaacttaaagtacctcaatctagggaacactcccatg
aaggatgatgacatgaagttagcctgcgaagcgctgaaacatccaaagtgctccgtggag
actctgaggttggattcctgtgagttaaccatcattggttatgagatgatctccacgctt
cttatttcaaccaccaggctaaagtgtctcagcctggccaaaaatagagtgggagtaaaa
agcatgatatcccttgggaatgccttgagtagctcaatgtgtctactgcaaaagttgata
ctggacaactgtggcctcacacctgccagctgccaccttctggtctcagcccttttcagc
aaccagaacttgacacacctgtgcctgtcaaacaacagcctggggactgaaggagtgcaa
cagctgtgtcagttcctgaggaatccagaatgtgctctccagcggctgatactgaatcac
tgcaacattgtagatgatgcttatggcttcctggcaatgagacttgcaaacaacacaaag
ctgacccacctgagcctgaccatgaaccccgtaggggatggtgcaatgaagctactgtgt
gaagctttaaaggaacctacttgttaccttcaagaactggaactagtggactgccaactc
acacagaactgctgcgaggacctggcctgtatgatcacaacaaccaagcacttaaaaagt
ttggatcttggtaacaacgccctgggtgacaaaggagtcataaccctgtgtgagggactg
aagcaaagtagcagctccctgaggagacttgggttgggggcatgtaagttgacttccaat
tgctgtgaggcattgtcattggccatctcttgcaaccctcacctgaacagcctaaacctg
gtgaagaatgacttcagtacatcggggatgttgaagctgtgctctgcgttccaatgccct
gtctctaacctggggataattggcctgtggaagcaggagtactatgcccgagtgagaaga
cagctggaggaagttgagtttgtcaagccccacgtggtgattgatggtgattggtatgct
agtgatgaagatgaccgaaactggtggaaaaactga

DBGET integrated database retrieval system