KEGG   Mus musculus (mouse): 23980Help
Entry
23980             CDS       T01002                                 

Gene name
Pebp1, HCNP, Pbp, Pbp1, Pbpr, Rkip
Definition
(RefSeq) phosphatidylethanolamine binding protein 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 F; 5 56.88 cM
AA seq 187 aa AA seqDB search
MAADISQWAGPLCLQEVDEPPQHALRVDYAGVTVDELGKVLTPTQVMNRPSSISWDGLDP
GKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSDYVGSGPPSGTGLHRY
VWLVYEQEQPLSCDEPILSNKSGDNRGKFKVETFRKKYNLGAPVAGTCYQAEWDDYVPKL
YEQLSGK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgacatcagccagtgggccgggcccttgtgcttgcaggaggtggacgagccg
ccccagcacgccctgcgggtcgactacgccggggtgacggtggacgagctgggcaaagtg
ctaacgcccacccaggttatgaacaggcccagcagcatttcatgggacggccttgatcct
gggaaactctacaccctggtcctcacagaccccgatgctcccagcaggaaggatcccaaa
ttcagggagtggcaccacttcctggtggtcaacatgaagggtaatgacattagcagtggc
actgtcctctcagattatgtgggctccgggcctcccagtggcacaggtctccaccgctat
gtctggctggtgtacgagcaggaacagccgctgagctgcgacgagcccattctcagcaac
aagtctggagacaatcgcggcaagttcaaggtggagaccttccgcaagaagtataacctg
ggagccccggtggcgggcacgtgctaccaagccgagtgggatgactatgtgcccaagctg
tacgagcagctgtcagggaagtag

DBGET integrated database retrieval system