KEGG   Mus musculus (mouse): 240028Help
Entry
240028            CDS       T01002                                 

Gene name
Lnpep, 2010309L07Rik, 4732490P18Rik, CAP, IRAP, PLAP, gp160, vp165
Definition
(RefSeq) leucyl/cystinyl aminopeptidase (EC:3.4.11.3)
  KO
K01257  
cystinyl aminopeptidase [EC:3.4.11.3]
Organism
mmu  Mus musculus (mouse)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    240028 (Lnpep)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     240028 (Lnpep)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M1
   240028 (Lnpep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17; 17 A3.2
AA seq 1025 aa AA seqDB search
MESFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMDEDEEDYESSAKLLGMSFMNRSSGLRNSAAGYRQSPDGTCSLPSARTLVICVFVIVV
AVSVIMVIYLLPRCTFTKEGCHKTNQSAELIQPVATNGKVFPWAQIRLPTAIIPLCYELS
LHPNLTSMTFRGSVTISLQALQDTRDIILHSTGHNISRVTFMSAVSSQEKQVEILEYPYH
EQIAVVAPEPLLTGHNYTLKIEYSANISNSYYGFYGITYTDKSNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKITRNEHHTALSNMPKKSSVPAEEGLIQDEFSESVKMSTYLVA
FIVGEMRNLSQDVNGTLVSVYAVPEKIGQVHHALDTTIKLLEFYQTYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDNATSSVADRKLVTKIIAHELAHQWFGNLVTMQWW
NDLWLNEGFATFMEYFSVEKIFKELNSYEDFLDARFKTMRKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGASLLLMLKSYLSEDVFRHAVILYLHNHSYAAIQSDDLWDSFNEVTDKT
LDVKKMMKTWTLQKGFPLVTVQRKGTELLLQQERFFLRMQPESQPSDTSHLWHIPISYVT
DGRNYSEYRSVSLLDKKSDVINLTEQVQWVKVNSNMTGYYIVHYAHDDWTALINQLKRNP
YVLSDKDRANLINNIFELAGLGKVPLRMAFDLIDYLKNETHTAPITEALFQTNLIYNLLE
KLGHMDLSSRLVARVHKLLQNQIQQQTWTDEGTPSMRELRSALLEFACAHSLENCTTMAT
NLFDSWMASNGTQSLPTDVMVTVFKVGARTEKGWLFLFSMYSSMGSEAEKNKILEALASS
EDVHKLYWLMKSSLDGDIIRTQKLSLIIRTVGRHFPGHLLAWDFVKENWNKLVHKFHLGS
YTIQSIVAGSTHLFSTKTHLSEVQAFFENQSEATLKLRCVQEALEVIQLNIQWMVRNLKT
LSQWL
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggagtcctttaccaatgatcggcttcagcttccaaggaatatgatcgaaaacagcatg
tttgaagaagagccagatgtggtagatttagccaaagaaccttgtttacatcctctggaa
cccgatgaagtggaatatgagccccgaggttcgaggcttctggtgcgaggtcttggtgag
catgagatggacgaggatgaagaggattatgagtcctctgcgaagctgctgggcatgtcc
ttcatgaacagaagctcaggcctgcggaacagtgcagcaggctacaggcagagtccagat
gggacttgttcattaccctctgccaggaccttagtgatctgtgtttttgtcattgtggtt
gcggtctctgtaatcatggtgatttatctactgcctagatgtacctttaccaaagaaggc
tgccacaaaacaaaccagtcagcagaactcatccagccagttgctacaaacgggaaagtg
ttcccatgggctcaaattaggcttcccactgccattattcctctatgctatgaacttagc
ctacatccaaacctaacctcaatgacattcaggggatctgtgacaatttcacttcaggct
cttcaagacacacgggatatcattctccatagcacaggacataatatttcaagagtgaca
tttatgtcagcagtttcaagtcaagaaaaacaagttgaaattctggaatatccatatcat
gaacaaatcgccgttgttgccccggaacctcttctaacaggacacaattataccctgaag
atagagtattcagcaaatatatctaactcttattatgggttttatggcatcacctacaca
gataaaagtaatgagaaaaagtactttgcagcaactcagtttgaacctctggcagcaaga
tctgcttttccttgttttgatgaaccagcatttaaggccacatttatcatcaagatcaca
aggaatgagcaccatactgcgttatcaaatatgcctaagaagtcatcggtccctgcagaa
gaaggacttattcaagatgagttttctgaaagtgtgaaaatgagcacatacctggttgct
ttcattgtaggggagatgaggaacctgagtcaggatgtaaatggaactctggtttctgtg
tatgctgtaccagaaaaaattggtcaagttcaccatgccttggacacaactataaagctt
cttgagttttatcaaacttactttgaaattcagtacccacttaagaaattggatttggtg
gccattcctgactttgaagcaggagcaatggaaaactggggcctgcttacattccgagaa
gagactcttctgtatgacaatgcaacttcttcagtagcagacagaaaactggtcactaaa
atcattgctcacgaactggcacatcagtggtttggaaatctggttacaatgcagtggtgg
aatgacctgtggctaaatgaaggctttgccactttcatggagtatttctctgtggaaaaa
atattcaaagagctcaacagttatgaagacttcttagatgctcgatttaaaaccatgagg
aaagattccttgaattcgtctcatccaatatcatcatctgttcagtcttcggaacaaata
gaagaaatgtttgattctctctcctattttaagggagcttctctcttgttgatgctgaaa
agttaccttagtgaagatgtatttcggcatgctgtcattctttacctgcacaatcacagc
tatgcagctatccaaagtgatgatctctgggacagcttcaatgaggtcacagacaaaact
ctagatgtaaagaaaatgatgaaaacctggaccctacagaaaggattcccgttagtgaca
gtccagaggaaggggactgagcttcttctacaacaggaaagattttttctacgcatgcaa
ccagaaagtcagccttcagatacaagccacctttggcatattccaatatcctatgtcact
gatggaagaaactattcagaatatcgatcagtttcactactggacaagaaatcagatgtc
atcaatcttacagaacaagtgcagtgggtcaaagtcaattcaaacatgactggctattac
attgttcactatgctcatgatgactggacagctctaatcaatcagttaaaaagaaaccct
tatgttctgagtgacaaagaccgagccaacctgatcaataacatctttgaacttgcaggt
cttggcaaagtgcctcttcggatggcatttgatttgattgactatcttaaaaatgagacc
cacactgcaccgatcactgaagccctgttccagacaaaccttatctataatctcctagaa
aaactggggcacatggacctgtcctcaagattggtggccagagtacataaattgctccag
aaccaaatccagcagcagacttggacagatgaaggcacaccatccatgcgagagcttcgg
tcagccttgctggaatttgcctgtgcccacagcctagagaactgtaccactatggccaca
aatctgtttgacagttggatggcatcaaatggaactcagagcctgcctactgatgtcatg
gtcactgtgttcaaggtgggagcgagaaccgagaaaggctggttgttcctctttagcatg
tattcctccatgggctctgaagcagaaaagaataaaattcttgaagctcttgccagctca
gaggatgtacataaactttactggttaatgaaaagtagccttgatggtgacatcatccga
acacagaagttgtcacttatcattagaacagtgggcagacattttcctggacacttgctg
gcttgggattttgttaaagaaaactggaataagcttgtacataagttccatctgggctcc
tataccatacaaagtattgttgctggatctactcacttattttcaacaaagacacattta
tctgaggtccaggcattctttgaaaatcagtcagaggcaaccttgaagcttcggtgtgtt
caggaggctttggaagtgattcagctgaatatccagtggatggtcaggaatctgaaaacg
ctctcccagtggctgtag

DBGET integrated database retrieval system