KEGG   Mus musculus (mouse): 240119Help
Entry
240119            CDS       T01002                                 

Gene name
St6gal2, C230064G14Rik, St6galII, mKIAA1877
Definition
beta galactoside alpha 2,6 sialyltransferase 2 (EC:2.4.99.1)
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    240119 (St6gal2)
   00514 Other types of O-glycan biosynthesis
    240119 (St6gal2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     240119 (St6gal2)
Glycosyltransferases [BR:mmu01003]
 Terminal extension
  Sialyltransferase
   240119 (St6gal2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17 C; 17
AA seq 438 aa AA seqDB search
MKPHLKQWRQRMLFGIFVWGLLFLAIFIYFTNSNPAAPMPSSFSFLERRGLLPLQGKQRV
IMGALQEPSLPRSLDASKVLLDSHPENPFHPWPGDPQKWDQAPNGFDNGDEFFTSQVGRK
SQSAFYPEEDSYFFVADQPELYHHRQGALELPSPGETSWRSGPVQPKQKLLHPRRGSLPE
EAYDSDMLSASMSRAFLYRLWKGAVSSKMLNPRLQKAMRYYMSFNKHGVRFRRRGRREAT
RTGPELLCEMRRRVRVRTLDGREAPFSGLGWRPLVPGVPLSQLHPRGLSSCAVVMSAGAI
LNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTVRIINSQILANPSHHFIDSALYKDV
ILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRRKYPTQPFYILHPKFIWQLWDIIQENT
REKIQPNPPSSGFIGTCV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggcgacaacgaatgctctttggaatatttgtttggggg
ctcctctttttggcaattttcatctacttcaccaacagcaatcctgcggcacctatgccc
agctccttttccttcctggagagacgtgggctcctgcctctacagggcaagcagcgggtc
atcatgggcgctttgcaggaaccctctttgcccagaagtttggatgcaagcaaagtgctg
ctggacagccaccctgagaaccctttccacccttggcctggggacccacagaaatgggat
caggccccaaatggctttgacaatggggatgagttttttacatcccaggttgggaggaaa
tcacaaagcgctttctatcccgaggaagatagctatttttttgttgcggatcagcctgag
ttgtaccaccacaggcagggtgcactggagctgccatctccaggggagacatcatggcga
tcaggacctgttcagcccaagcagaagctgctccacccaaggcgaggcagcttgcctgag
gaagcctatgacagcgacatgctgtcagcctccatgtcgagagccttcctgtaccggctc
tggaagggggccgtgtcctctaagatgttgaacccgcgcctgcagaaggccatgcgttac
tacatgtccttcaacaagcatggtgtgcgcttccgcaggcggggtcggcgtgaagctaca
cgtacagggccggagctgctgtgtgagatgcgcagacgtgtgcgtgtgcgcacgttggac
ggcagagaggcgcccttctcggggctgggctggcggcctctggtaccaggtgtacctctg
agccagttgcacccgcgcggtctgagcagctgcgcagttgtcatgtctgccggtgccatc
ctgaactcctccttgggggaggaaatcgattctcatgatgcagttttgagatttaactct
gcccctacacgtggctatgagaaagatgtcggaaataaaaccacagtacgcatcattaat
tctcagattctggccaaccccagccatcacttcattgacagtgctttatataaagatgtt
atcctggtagcctgggatcctgctccttattctgccaatcttaacctgtggtataagaag
ccagattacaaccttttcactccatatatccagcatcgccggaaatacccgactcagcca
ttttacattcttcaccccaagttcatatggcagctttgggacattatccaggagaataca
agggagaagatacagcccaacccaccatcttctggttttattggtacgtgtgtctaa

DBGET integrated database retrieval system