KEGG   Mus musculus (mouse): 240185Help
Entry
240185            CDS       T01002                                 

Gene name
Jcad, 1110056P05Rik, 9430020K01Rik, Gm328, mKIAA1462
Definition
(RefSeq) junctional cadherin 5 associated
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 A1
AA seq 1320 aa AA seqDB search
MYSVEDLLISHGYKPARDAAAPCEDKSERCRSTRTGPRAGQGLLNGYKDGATAHTHSRTS
LGTGHVSNSENRISRPRGHREHQSTSRTPEARFLNQPSLAWSSQPQSGRDDIYWSRGRQE
GSGSLCPRDWKELESRGMAQAYSLPVHVRENLWEVAGRTEHVMKNAIWEEELRMQDMSLE
SWKKPRELGRQASDGDGRKRPQEKFEGLYPFVHGEHTSQNRKKSQSLPRALSPKSLNFTE
IPVPLHDGHITGVPKVPPYPPSFPSPSEPMRNLEKASSSGPFPRPKFGKPLKTPCYSSHS
QPRGEGGFQDHQHRDPRGSYPTRSKDPSHELGMLDPGLEPPVYVPPPSYRSPPQHIPNPY
LEDPVPRHVSSNQSQQQVPEKPETSCPLPSGSLAARDLYDAMPGSPPQGLPPQPYPIATH
GGSIQYIPFDDPRIRHIKLAQPPEFYEEAKLDDTSYNPGLLTTQEPAIGKRQYDDAPSVP
RGPTPSPVNEQSSAFVHSSPRWLQGQLPLGIGPGGFHGQTEHHVMGGLTTNVTDIKAEGH
ASSPQPQSEGTCKTYTKLRKFETGVQSKKSSKKKSNATIFCLVSIPVKSESLVLATDTNN
NDFKLVADKTRGLCQGSALQEQSLLSMSSTDLELQALMGSMAWRRTSPRQGLRESEDGQI
DDPRILHLIKPKELQASSPWPGHQYRDQQTQTSFHEDSKSSQLLPATKPGEASNVAPTPT
CPDTTASEVCLHTALAFSDQNQKPSVPHLQGQTSLSPSRNSAFSRTSSAINQASMSKGTS
DQLPGANPVPKPEVVKGESTTGQCNSTQLFGQFLLKPVSRRPWDLISQLESFNKELQEEE
ESHGGSGSEDSEAEQPEDCADSRTKSWALQGTRTAQQPAGLALENVASPDRRLNDSQSWN
EEPKPGHSSVHPQSLGPSQEEGSRGVPVQWADGSLTAEQKSQEDLNGMCERDFSPRPVSR
IAPIDTKAAPLYCLSEPRGSQELTKFGDAVGSVQLGRETPTQVGNGGDTEVLPCVLLPLA
DKYRGHSTPDFRSLELTLGQEQNAYKLECLDLENTVEVLPSESLQERAERILGIEVAVES
LLPSARRTEQSQLPEPDASACNPSSSREDSSHSLALPVGPKVATDAFYGRRKCGWTESPL
FVGERAPQASICSDVDGFPTSQATSPEPGKKDEEAKAPFKSTLFHFMEKSTNVVGPEKRL
RNPSKVVENLQEKLVSPPKKADSVHLIRMREVNSLSQMRCLSSKSADSVEEPDPLKVIKS
SAWLSEGLTSLGGKDEAWQAGHLPSVSQNENGHPEVPRDKMSDQDLWCADSYDPSRVERV
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgtatagtgtggaagatctcctgatttctcatggatacaaaccagcccgagatgccgca
gcaccatgtgaggacaaatcagagagatgcaggtcgacaaggacaggaccccgagctggc
caaggcctattgaatgggtacaaggatggcgctacagcccatacgcacagtaggacatcc
ctggggacaggacacgtgagcaactctgaaaaccgcatcagcaggccaagaggccacagg
gagcaccaaagcacttctagaactcctgaggcacggtttttaaatcaaccctccttagca
tggtcctctcagccccaaagtggtagagacgacatctactggagcagaggaagacaggag
ggcagtggctccctgtgtcccagggactggaaagaactggaaagcagaggaatggctcag
gcttacagtctgcccgtccatgtgagagagaatctgtgggaagttgcaggaaggacagag
catgtgatgaagaatgccatctgggaagaagagctgagaatgcaggacatgagcttggaa
agctggaagaagccaagggagttagggaggcaggcatccgatggggatggacggaaaagg
ccccaggaaaagttcgagggtctgtacccatttgttcatggggagcacacgtctcagaac
agaaaaaaatcccagtcattgccccgagctctttctcctaagagcctgaatttcacagaa
attcctgttccactacatgatggtcacataacaggtgtcccaaaagtgccaccatatcct
cctagcttcccatccccttcggaacccatgaggaaccttgagaaggctagctcctcaggc
ccttttcccaggcctaagtttgggaaaccccttaagactccgtgttatagctctcactca
cagcccaggggagaaggtggatttcaggaccaccagcacagggacccacgtggctcctac
ccaacaagaagtaaggatcccagccatgagttgggtatgctggatcctggcttggagccc
ccagtgtatgtgcctccaccttcatataggtcaccccctcagcacattccaaacccatac
cttgaagatcctgtgcccaggcatgtgagcagcaaccagagtcagcagcaagtacctgag
aaacctgagaccagctgtccacttccttctggctctcttgcagctagggatctctatgat
gcaatgcctggctctcctccgcaaggtcttcctccacaaccctatcctattgccacccat
gggggttctattcagtacattccatttgatgatccacggatccgacatatcaaactagct
cagcccccagaattctatgaagaggcaaagcttgatgatacatcctataaccctggttta
ctcactacccaagagccagccattgggaaaagacagtacgatgatgccccttcggtacca
cggggcccaacgccttcaccagtcaatgagcagagctctgcctttgtccattccagtccc
cggtggctgcagggccagctccccctgggcattggacctggaggcttccatggccaaaca
gagcatcatgtcatgggcggattaacaactaatgtgacagacatcaaggcagaaggccat
gcctcttcaccacagccacagagtgagggtacctgcaaaacctacactaagctcagaaag
tttgaaactggggttcagagcaagaaaagttcaaagaagaaaagtaacgcaactatattt
tgtttggtctccatcccagttaaatctgagtcacttgtgctagctacggatacaaacaac
aatgactttaagctggttgctgataagacccgagggctgtgccagggttcagccctgcag
gagcagagtctgctgagtatgtcttccactgacctggagctgcaagccctcatgggaagc
atggcttggagaagaacatctccaaggcaaggtctgagggagtcagaagatggccaaatt
gatgaccccagaatcctccatctcatcaaacccaaagaacttcaggcttccagcccttgg
ccaggacaccaatacagagatcaacagacccaaaccagtttccatgaagactccaaaagc
tcacagctcctccctgccacaaagccaggagaggccagcaatgtagctccgaccccaaca
tgcccagataccactgcctccgaagtatgcctccatacagccttagcattcagtgatcaa
aatcagaagcccagtgtacctcacctccaaggacaaacgtcccttagcccgtctcgaaac
agtgctttctcaaggacttcctcagccataaaccaggcatctatgtccaaagggacctct
gaccagctccctggtgccaaccctgttcccaagccagaggtggtgaagggggagtccaca
acaggccagtgcaatagcacacaactcttcggtcagtttctcttgaaaccagttagccgg
cggccctgggatttgataagtcagttagaaagttttaacaaggaacttcaggaagaggaa
gaaagccatggtggtagtggtagtgaggacagtgaggcagaacagccagaggactgtgca
gattccagaaccaagtcctgggctctccagggaactagaacagcacagcagcctgcaggg
ctggcgctggagaatgtagcttccccagatagaagacttaatgactcacagagctggaat
gaagaaccaaagcctggccactcaagtgtccatccacagtccctgggcccatcacaggag
gaaggcagcagaggtgttccagtccaatgggcagatggaagcctgactgcagagcagaaa
agccaggaggatttgaatgggatgtgtgagcgagactttagcccaaggcctgtgagcagg
attgcacccattgacacaaaagcagcccctttatactgtctgtcagaaccaagaggaagt
caagaactcaccaaattcggcgatgctgtagggtctgtgcagctgggcagagagactccc
acacaggtgggtaatggtggggacacagaggtcctaccctgtgtccttctgccactggct
gacaaatatcgaggccactcaacaccagactttcggtctttagagctcacactgggacaa
gaacagaatgcctataaattagagtgtctggatttagagaacaccgtggaagtccttcca
agtgagtctctgcaggaaagggcagagaggatcctgggcatagaggtggccgtggagtcc
cttctgccaagtgccaggagaacagaacaaagccagcttcctgagcctgatgcaagtgcc
tgcaacccaagttcatccagagaggactcatcacacagcttggcactaccagtggggccc
aaagtggccactgacgccttctatggcaggaggaagtgtggctggactgagagtcctctt
tttgtaggagaaagggccccccaggcttctatatgctcagatgtggatggcttccctaca
agccaggccaccagtcctgagcctgggaaaaaggatgaggaggcgaaagcacccttcaag
tccactctgttccatttcatggaaaagtccacaaatgtggtgggtcctgaaaagaggctc
agaaacccttccaaagtggttgagaacttacaagaaaaactggtatcacccccaaaaaag
gcagactctgttcacttgataagaatgagggaggtcaactccttgtctcagatgaggtgt
ctgagctccaagagcgctgactccgtggaggagcctgaccccttaaaggtcatcaaaagt
tcagcctggctttcagaaggccttacttccctgggtggtaaagacgaagcctggcaagca
gggcacctgccctctgtctctcagaatgaaaacggacaccccgaagtgccgagggacaag
atgtcagaccaagacttgtggtgtgcagattcctatgatccaagccgagtggagagggtg
tga

DBGET integrated database retrieval system