KEGG   Mus musculus (mouse): 24046Help
Entry
24046             CDS       T01002                                 

Gene name
Scn11a, NSS2, NaN, NaT, NaV1.9, SNS2
Definition
(RefSeq) sodium channel, voltage-gated, type XI, alpha
  KO
K04843  
voltage-gated sodium channel type XI alpha
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   24046 (Scn11a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
9 71.33 cM; 9 F3-F4
AA seq 1765 aa AA seqDB search
MEERYYPVIFPDERNFRPFTFDSLAAIEKRITIQKEKKKSKDKAATEPQPRPQLDLKASR
KLPKLYGDVPPDLIAKPLEDLDPFYKDHKTFMVLNKKRTIYRFSAKRALFILGPFNPIRS
FMIRISVHSVFSMFIICTVIINCMFMANNSSVDSRPSSNIPEYVFIGIYVLEAVIKILAR
GFIVDEFSYLRDPWNWLDFIVIGTAIAPCFLGNKVNNLSTLRTFRVLRALKAISVISGLK
VIVGALLRSVKKLVDVMVLTLFCLSIFALVGQQLFMGILSQKCIKDDCGPNAFSNKDCFV
KENDSEDFIMCGNWLGRRSCPDGSTCNKTTFNPDYNYTNFDSFGWSFLAMFRVMTQDSWE
KLYRQILRTSGIYFVFFFVVVIFLGSFYLLNLTLAVVTMAYEEQNRNVAAETEAKEKMFQ
EAQQLLREEKEALVAMGIDRTSLNSLQASSFSPKKRKFFGSKTRKSFFMRGSKTARASAS
DSEDDASKNPQLLEQTKRLSQNLPVELFDEHVDPLHRQRALSAVSILTITMQEQEKSQEP
CFPCGKNLASKYLVWECSPPWLCIKKVLQTIMTDPFTELAITICIIVNTVFLAMEHHNMD
NSLKDILKIGNWVFTGIFIAEMCLKIIALDPYHYFRHGWNIFDSIVALVSLADVLFHKLS
KNLSFLASLRVLRVFKLAKSWPTLNTLIKIIGHSVGALGNLTVVLTIVVFIFSVVGMRLF
GAKFNKTCSTSPESLRRWHMGDFYHSFLVVFRILCGEWIENMWECMQEMEGSPLCVIVFV
LIMVVGKLVVLNLFIALLLNSFSNEEKDGNPEGETRKTKVQLALDRFSRAFYFMARALQN
FCCKRCRRQNSPKPNEATESFAGESRDTATLDTRSWKEYDSEMTLYTGQAGAPLAPLAKE
EDDMECCGECDASPTSQPSEEAQACDLPLKTKRLPSPDDHGVEMEVFSEEDPNLTIQSAR
KKSDAASMLSECSTIDLNDIFRNLQKTVSPQKQPDRCFPKGLSCIFLCCKTIKKKSPWVL
WWNLRKTCYQIVKHSWFESFIIFVILLSSGALIFEDVNLPSRPQVEKLLKCTDNIFTFIF
LLEMILKWVAFGFRKYFTSAWCWLDFLIVVVSGLSLTNLPNLKSFRNLRALRPLRALSQF
EGMKVVVNALMSAIPAILNVLLVCLIFWLIFCILGVNFFSGKFGRCINGTDINKYFNASN
VPNQSQCLVSNYTWKVPNVNFDNVGNAYLALLQVATYKGWLDIMNAAVDSRGKDEQPAFE
ANLYAYLYFVVFIIFGSFFTLNLFIGVIIDNFNQQQKKLGGQDIFMTEEQKKYYNAMKKL
GTKKPQKPIPRPLNKCQAFVFDLVTSQVFDVIILGLIVTNMIIMMAESEGQPNEVKKIFD
ILNIVFVVIFTVECLIKVFALRQHYFTNGWNLFDCVVVVLSIISTLVSGLENSNVFPPTL
FRIVRLARIGRILRLVRAARGIRTLLFALMMSLPSLFNIGLLLFLVMFIYAIFGMNWFSK
VKRGSGIDDIFNFDTFSGSMLCLFQITTSAGWDALLNPMLESKASCNSSSQESCQQPQIA
IVYFVSYIIISFLIVVNMYIAVILENFNTATEESEDPLGEDDFEIFYEIWEKFDPEATQF
IQYSSLSDFADALPEPLRVAKPNRFQFLMMDLPMVMGDRLHCMDVLFAFTTRVLGNSSGL
DTMKAMMEEKFMEANPFKKLYEPIVTTTKRKEEEECAAVIQRAYRRHMEKMIKLKLKGRS
SSSLQVFCNGDLSSLDVPKIKVHCD
NT seq 5298 nt NT seq  +upstreamnt  +downstreamnt
atggaggagaggtactatccagtgatcttcccagacgagaggaatttccgccccttcact
ttcgactctttggctgcaatagagaagcggatcaccatccaaaaggagaagaagaaatcc
aaagacaaggcagcaactgagccccagcctcggcctcagctcgacctaaaggcctccagg
aagttacctaagctctatggcgacgttccccctgaccttatagcgaagcccctggaagat
ctggacccattttacaaagaccataagacattcatggtattgaacaagaagagaacaatc
tatcgcttcagcgccaagagggccttgttcattctggggccttttaatcccatcagaagc
ttcatgattcgcatctctgtccattcagtcttcagcatgttcattatctgcacagtgatc
atcaactgtatgttcatggctaataattcttctgtggacagtcgtcctagcagtaacatt
cccgaatacgtcttcattgggatttatgttttagaagctgtgattaaaatattggcaaga
ggcttcattgtggatgagttttcctacctccgagatccttggaactggctggacttcatt
gtcatcggaacagcgatagcgccttgttttctcggtaacaaagtcaataatctttccact
ctacgtaccttccgagtgttgagagctctgaaagccatttctgtaatctcaggtctgaag
gtcatcgtgggtgccctgctgcgctccgtgaagaagctagtggacgtgatggtcctcact
ctcttttgcctcagcatctttgccctggttggtcagcagctcttcatgggaattctgagc
cagaaatgtattaaggacgactgtggccctaacgctttttccaacaaggattgctttgta
aaagaaaatgatagcgaggacttcataatgtgtggcaactggctcggcagaagatcctgc
cccgatggttccacgtgcaataaaaccacatttaacccagattataattatacaaacttt
gacagctttggctggtcttttctcgccatgttccgggttatgactcaagactcctgggag
aagctttatcgacagatccttcgcacctccgggatctactttgtcttcttcttcgtggtc
gtcatcttcctgggctctttctacctgcttaacttaaccctggctgtcgtcaccatggct
tacgaggaacagaacagaaatgtcgctgccgagacagaggccaaggagaagatgtttcag
gaagcccagcagctgttgagggaggaaaaggaggctctggttgccatgggaattgacaga
acttcccttaattccctccaagcttcgtccttttccccaaagaagaggaagttttttggc
agtaagacaagaaagtccttctttatgagagggtccaagacagcccgagcctcagcgtcc
gattcagaggacgatgcctctaaaaacccacaactccttgagcaaacaaaacgactatcc
cagaacttgcccgtagaactctttgatgagcacgtggaccccctccataggcagagagcg
ctgagtgccgtcagtatcttaaccatcaccatgcaggaacaagaaaaatcccaggagcct
tgtttcccgtgtgggaaaaacttggcatccaagtacctggtgtgggaatgtagccctccg
tggctgtgcataaagaaggtcctgcagactatcatgacagaccccttcactgagctggcc
atcaccatctgcatcatcgtcaatactgtcttcttggccatggaacaccacaatatggat
aactctttaaaagacatactgaaaataggaaactgggttttcactggaattttcatagcg
gaaatgtgtctcaagatcattgcgctagacccttaccactacttccggcacggctggaac
atctttgacagcattgtggcccttgtgagtctcgctgacgtgctcttccacaaactgtct
aaaaacctctccttcttggcttccctcagagtgctgagggtcttcaagttagccaaatcc
tggcccacattaaacactctcattaagatcatcggccactccgtgggtgcgctcggaaac
ctgactgtggtcctaacgatcgtggtcttcatcttttccgtggttggcatgcggctcttt
ggtgccaagtttaacaagacttgctccacctctccggagtccctccggcgctggcacatg
ggtgatttctaccattccttcctggtggtgttccgcatcctctgtggggagtggatcgag
aacatgtgggaatgcatgcaggagatggaaggctccccgctgtgtgtcatcgtctttgtg
ctgatcatggtggtcgggaagctcgtggtgcttaacctcttcattgccttgctgctcaat
tccttcagcaatgaggaaaaggatgggaacccagaaggagagaccaggaaaaccaaagtg
cagctagccctggatcggttcagccgagcgttctacttcatggcgcgcgctcttcagaat
ttctgttgcaagagatgcaggaggcaaaactcgccaaagccaaatgaggcaacagaaagc
tttgctggtgagagtagagacacagccaccctggatacaaggtcctggaaggagtatgat
tcagaaatgactctgtacactgggcaggccggggctccactggccccactggcaaaagaa
gaggacgatatggaatgttgtggtgaatgtgatgcctcacctacctcacagcctagtgag
gaagctcaggcctgtgacctccctctgaagaccaagcggctccccagcccagatgaccac
ggggttgaaatggaagtgttttccgaagaagatccgaatttaaccatacagagtgctcga
aagaagtctgatgcggcaagcatgctctcagaatgcagcacaatagacctgaatgatatc
tttagaaatttacagaaaacagtttccccccaaaagcaaccagatcgatgctttcccaag
ggcctcagttgtatctttctatgttgcaaaacaatcaaaaaaaagtccccctgggtcctg
tggtggaatcttcggaaaacctgctaccaaatcgtgaagcatagctggtttgagagcttc
ataatttttgtcatcctgctgagcagcggagcactgatattcgaagatgtcaatcttccc
agccggccccaagttgaaaaattactgaagtgtaccgataatattttcacatttattttt
ctcctggaaatgattttgaagtgggtggcctttggattccggaagtatttcaccagtgcc
tggtgctggctcgatttcctcattgtggtggtgtctgggctcagcctcacgaacttacca
aacttgaagtccttccggaatctgcgagcgctgagacctctgcgggcactgtctcagttt
gaaggaatgaaggttgttgtcaatgccctcatgagtgccatacctgccatcctcaatgtc
ttgctggtctgcctcattttctggctcatattttgtatcctgggagtaaattttttttct
gggaagtttggaagatgcattaatggaacagacataaataaatatttcaacgcttccaat
gttccaaaccaaagccaatgtttagttagtaattacacgtggaaagtcccgaatgtcaac
tttgacaacgtggggaatgcctaccttgccctgctgcaagtggcgacctataagggctgg
ctggacattatgaatgcagctgttgattccagagggaaagatgagcagccggcctttgag
gcgaatctatacgcatacctttacttcgtggtttttatcatcttcggctcattctttacc
ctgaacctctttatcggtgttattattgacaacttcaatcagcagcagaaaaagttaggt
ggccaagacatttttatgacagaagaacagaagaaatattacaatgcaatgaaaaagtta
ggaaccaagaagcctcaaaagcccatcccaaggcccctgaacaaatgtcaagccttcgtg
ttcgatttggtcacaagccaggtctttgacgtcatcattctgggtcttattgtcacaaac
atgattatcatgatggctgaatctgaaggccagcccaacgaagtgaagaaaatctttgat
attctcaacatagtcttcgtggtcatctttaccgtagagtgtctcatcaaagtctttgct
ttgaggcaacactacttcaccaatggctggaacttatttgattgtgtggtcgtggttctt
tccatcattagtaccttggtttctggcttggagaacagcaacgtcttcccgcccacactc
ttcaggattgtccgcttggctcggatcggtcgaatcctcagactggtccgggcggctcga
ggaatcaggacactccttttcgcgttgatgatgtctctcccctctctcttcaacatcggt
ctgcttctctttctggtgatgttcatttatgccatctttgggatgaactggttttccaaa
gtgaagagaggctctgggattgatgacatcttcaactttgacactttctcgggcagcatg
ctctgcctcttccagataaccacttcagccggctgggatgctctcctcaaccccatgctg
gaatcaaaagcctcttgcaattcctcctcccaagagagctgtcagcagccgcagatagcc
atagtctacttcgtcagctacatcatcatctcctttctcattgtggttaacatgtacata
gctgtgattctagagaacttcaacacagccacagaggagagcgaggaccccctgggcgaa
gacgactttgagatcttctatgagatctgggagaagtttgaccccgaagcaacacagttc
atccagtactcatccctctctgacttcgccgacgccctgcccgagccgttgcgtgtggcc
aagcccaacaggtttcagtttctcatgatggacttgcccatggtgatgggtgatcgcctc
cattgcatggatgttctctttgctttcaccaccagggtcctcgggaactccagcggcttg
gataccatgaaagccatgatggaggagaagttcatggaggccaatcctttcaagaagttg
tacgagcccattgtcaccaccacaaagaggaaggaggaggaggaatgtgccgctgtcatc
cagagggcctaccggagacacatggagaagatgatcaagctgaagctgaaaggcaggtca
agttcatcgctccaggtgttttgcaatggagacttgtctagcttggatgtgcccaagatc
aaggttcattgtgactga

DBGET integrated database retrieval system