KEGG   Mus musculus (mouse): 24060Help
Entry
24060             CDS       T01002                                 

Gene name
Slc35a1, AA408150, AI314851
Definition
(RefSeq) solute carrier family 35 (CMP-sialic acid transporter), member 1
  KO
K15272  
solute carrier family 35 (UDP-sugar transporter), member A1/2/3
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   24060 (Slc35a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 A5
AA seq 336 aa AA seqDB search
MAPARENVSLFFKLYCLTVMTLVAAAYTVALRYTRTTAEELYFSTTAVCITEVIKLLISV
GLLAKETGSLGRFKASLSENVLGSPKELAKLSVPSLVYAVQNNMAFLALSNLDAAVYQVT
YQLKIPCTALCTVLMLNRTLSKLQWISVFMLCGGVTLVQWKPAQATKVVVAQNPLLGFGA
IAIAVLCSGFAGVYFEKVLKSSDTSLWVRNIQMYLSGIVVTLAGTYLSDGAEIQEKGFFY
GYTYYVWFVIFLASVGGLYTSVVVKYTDNIMKGFSAAAAIVLSTIASVLLFGLQITLSFA
LGALLVCVSIYLYGLPRQDTTSIQQEATSKERIIGV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atggctccggcgagagaaaatgtcagtttattcttcaagctgtactgcttgacggtgatg
actctggtggctgccgcttacaccgtagctttaagatacacaaggacaacagctgaagaa
ctctacttctcaaccactgccgtgtgtatcacagaagtgataaagttactgataagtgtt
ggcctgttagctaaggaaactggcagtttgggtagatttaaagcctcattaagtgaaaat
gtcttggggagccccaaggaactggcgaagttgagtgtgccatcactagtgtatgctgtg
cagaacaacatggccttcctggctctcagtaatctggatgcagcagtgtaccaggtgacc
tatcaactgaagatcccctgcactgctttatgtactgttttaatgttaaatcgaacactc
agcaaattacagtggatttccgtcttcatgctgtgtggtggggtcacactcgtacagtgg
aaaccagcccaagctacaaaagtcgtggtagcgcagaatccattgttaggctttggtgct
atagctattgctgtattgtgctctggatttgcaggagtttattttgaaaaagtcttaaag
agttccgacacttccctttgggtgagaaacattcagatgtatctgtcagggatcgttgtg
acgttagctggtacctacttgtcagatggagctgaaattcaagaaaaaggattcttctat
ggctacacgtattatgtctggtttgttatcttccttgctagtgtgggaggcctctacacg
tcagtggtggtgaagtatacagacaacatcatgaaaggcttctctgctgccgcagccatt
gttctttctaccattgcttcagtcctactgtttggattacagataacactttcatttgca
ctgggagctcttcttgtgtgtgtttccatatatctctatgggttacccagacaagatact
acatccattcaacaagaagcaacttcaaaagagagaatcattggtgtgtga

DBGET integrated database retrieval system