KEGG   Mus musculus (mouse): 24088Help
Entry
24088             CDS       T01002                                 

Gene name
Tlr2, Ly105
Definition
(RefSeq) toll-like receptor 2
  KO
K10159  
toll-like receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
PI3K-Akt signaling pathway
Toll-like receptor signaling pathway
Legionellosis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Malaria
Toxoplasmosis
Amoebiasis
Tuberculosis
Hepatitis B
Measles
Herpes simplex infection
Proteoglycans in cancer
Inflammatory bowel disease (IBD)
Rheumatoid arthritis
Module
Toll-like receptor signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    24088 (Tlr2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    24088 (Tlr2)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    24088 (Tlr2)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    24088 (Tlr2)
  Immune diseases
   05323 Rheumatoid arthritis
    24088 (Tlr2)
   05321 Inflammatiory bowel disease (IBD)
    24088 (Tlr2)
  Infectious diseases
   05134 Legionellosis
    24088 (Tlr2)
   05152 Tuberculosis
    24088 (Tlr2)
   05162 Measles
    24088 (Tlr2)
   05161 Hepatitis B
    24088 (Tlr2)
   05168 Herpes simplex infection
    24088 (Tlr2)
   05146 Amoebiasis
    24088 (Tlr2)
   05144 Malaria
    24088 (Tlr2)
   05145 Toxoplasmosis
    24088 (Tlr2)
   05140 Leishmaniasis
    24088 (Tlr2)
   05142 Chagas disease (American trypanosomiasis)
    24088 (Tlr2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   24088 (Tlr2)
Cellular antigens [BR:mmu04090]
 Proteins
  24088 (Tlr2)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   24088 (Tlr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3; 3 E3
AA seq 784 aa AA seqDB search
MLRALWLFWILVAITVLFSKRCSAQESLSCDASGVCDGRSRSFTSIPSGLTAAMKSLDLS
FNKITYIGHGDLRACANLQVLMLKSSRINTIEGDAFYSLGSLEHLDLSDNHLSSLSSSWF
GPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTLRIGNVETFSEIRRIDFAGLTSLNELE
IKALSLRNYQSQSLKSIRDIHHLTLHLSESAFLLEIFADILSSVRYLELRDTNLARFQFS
PLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSEVEFDDCTLNGLGDFNPSES
DVVSELGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKRITVENSKVFLVPCSFSQHLK
SLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHLRSMQKTGEILLTLKNLTSLDI
SRNTFHPMPDSCQWPEKMRFLNLSSTGIRVVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQ
ELYISRNKLKTLPDASLFPVLLVMKIRENAVSTFSKDQLGSFPKLETLEAGDNHFVCSCE
LLSFTMETPALAQILVDWPDSYLCDSPPRLHGHRLQDARPSVLECHQAALVSGVCCALLL
LILLVGALCHHFHGLWYLRMMWAWLQAKRKPKKAPCRDVCYDAFVSYSEQDSHWVENLMV
QQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTVFVLSENFVRSEWCKYELDFS
HFRLFDENNDAAILVLLEPIERKAIPQRFCKLRKIMNTKTYLEWPLDEGQQEVFWVNLRT
AIKS
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atgctacgagctctttggctcttctggatcttggtggccataacagtcctcttcagcaaa
cgctgttctgctcaggagtctctgtcatgtgatgcttctggggtgtgtgatggccgctcc
aggtctttcacctctattccctccggactcacagcagccatgaaaagccttgacctgtct
ttcaacaagatcacctacattggccatggtgacctccgagcgtgtgcgaacctccaggtt
ctgatgttgaagtccagcagaatcaatacaatagagggagacgccttttattctctgggc
agtcttgaacatttggatttgtctgataatcacctatctagtttatcttcctcctggttc
gggcccctttcctctttgaaatacttaaacttaatgggaaatccttaccagacactgggg
gtaacatcgctttttcccaatctcacaaatttacaaaccctcaggataggaaatgtagag
actttcagtgagataaggagaatagattttgctgggctgacttctctcaatgaacttgaa
attaaggcattaagtctccggaattatcagtcccaaagtctaaagtcgatccgcgacatc
catcacctgactcttcacttaagcgagtctgctttcctgctggagatttttgcagatatt
ctgagttctgtgagatatttagaactaagagatactaacttggccaggttccagttttca
ccactgcccgtagatgaagtcagctcaccgatgaagaagctggcattccgaggctcggtt
ctcactgatgaaagctttaacgagctcctgaagctgttgcgttacatcttggaactgtcg
gaggtagagttcgacgactgtaccctcaatgggctcggcgatttcaacccctcggagtca
gacgtagtgagcgagctgggtaaagtagaaacagtcactatccggaggttgcatatcccc
cagttctatttgttttatgacctgagtactgtctattccctcctggagaaggtgaagcga
atcacagtagagaacagcaaggtcttcctggttccctgctcgttctcccagcatttaaaa
tcattagaattcttagacctcagcgaaaatctgatggttgaagaatatttgaagaactca
gcctgtaagggagcctggccttctctacaaaccttagttttgagccagaatcatttgaga
tcaatgcaaaaaacaggagagattttgctgactctgaaaaacctgacctctcttgacatc
agcaggaacacttttcatccgatgcccgacagctgtcagtggccagaaaagatgcgcttc
ctgaatttgtccagtacagggatccgggtggtaaaaacgtgcattcctcagacgctggag
gtgttggatgttagtaacaacaatcttgactcattttctttgttcttgcctcggctgcaa
gagctctatatttccagaaataagctgaaaacactcccagatgcttcgttgttccctgtg
ttgctggtcatgaaaatcagagagaatgcagtaagtactttctctaaagaccaacttggt
tcttttcccaaactggagactctggaagcaggcgacaaccactttgtttgctcctgcgaa
ctcctatcctttactatggagacgccagctctggctcaaatcctggttgactggccagac
agctacctgtgtgactctccgcctcgcctgcacggccacaggcttcaggatgcccggccc
tccgtcttggaatgtcaccaggctgcactggtgtctggagtctgctgtgcccttctcctg
ttgatcttgctcgtaggtgccctgtgccaccatttccacggactgtggtacctgagaatg
atgtgggcgtggctccaggccaagaggaagcccaagaaagctccctgcagggacgtttgc
tatgatgcctttgtttcctacagtgagcaggattcccattgggtggagaacctcatggtc
cagcagctggagaactctgacccgccctttaagctgtgtctccacaagcgggacttcgtt
ccgggcaaatggatcattgacaacatcatcgattccatcgaaaagagccacaaaactgtg
ttcgtgctttctgagaacttcgtacggagcgagtggtgcaagtacgaactggacttctcc
cacttcaggctctttgacgagaacaacgacgcggccatccttgttttgctggagcccatt
gagaggaaagccattccccagcgcttctgcaaactgcgcaagataatgaacaccaagacc
tacctggagtggcccttggatgaaggccagcaggaagtgttttgggtaaatctgagaact
gcaataaagtcctag

DBGET integrated database retrieval system