KEGG   Mus musculus (mouse): 240913Help
Entry
240913            CDS       T01002                                 

Gene name
Adamts4, ADAM-TS4, ADAMTS-2, ADMP-1
Definition
(RefSeq) a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4 (EC:3.4.24.82)
  KO
K07764  
a disintegrin and metalloproteinase with thrombospondin motifs 4 [EC:3.4.24.82]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.82  ADAMTS-4 endopeptidase
     240913 (Adamts4)
Peptidases [BR:mmu01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   240913 (Adamts4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H3; 1 79.28 cM
AA seq 833 aa AA seqDB search
MSQMGLHPRRGLTGHWLQRFQPCLPLHTVQWRRLLLLAFLLSLAWPASPLPREEEIVFPE
KLNGSSILPGSGVPARLLYRLPAFGEMLLLELEQDPGVQVEGLTVQYLGQAPEMLGGAEP
GTYLTGTINGDPESVASLHWDGGALLGVLQYRGAELHLQPLEGGALNSAGGPGAHILRRK
SPASSQGPMCTVKAPSGSPSPISRRTKRFASLSRFVETLVVADDKMAAFHGTGLKRYLLT
VMAAAAKAFKHPSIRNPVNLVVTRLVILGSGQEGPQVGPSAAQTLRSFCTWQRGLNTPND
SDPDHFDTAILFTRQDLCGVSTCDTLGMADVGTVCDPARSCAIVEDDGLQSAFTAAHELG
HVFNMLHDNSKPCTNLNGQGGSSRHVMAPVMAHVDPEEPWSPCSARFITDFLDNGYGHCL
LDKPEAPLHLPATFPGKDYDADRQCQLTFGPDSSHCPQLPPPCAALWCSGHLNGHAMCQT
KHSPWADGTPCGSSQACMGGRCLHVDQLKDFNVPQAGGWGPWGPWGDCSRTCGGGVQFSS
RDCTRPVPRNGGKYCEGRRTRFRSCNTENCPHGSALTFREEQCAAYNHRTDLFKSFPGPM
DWVPRYTGVAPRDQCKLTCQARALGYYYVLEPRVADGTPCSPDTSSVCVQGRCIHAGCDR
IIGSKKKFDKCMVCGGDGSRCSKQSGSFKKFRYGYSDVVTIPAGATHILVRQQGGSGLKS
IYLALKLSDGSYALNGEYTLMPSPTDVVLPGAVSLRYSGATAASETLSGHGPLAQPLTLQ
VLVAGNPQNARLRYSFFVPRPVPSTPRPPPQDWLQRRAEILKILRKRPWAGRK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagatgggcttgcatcccaggaggggcttgactgggcactggctgcaaagattc
caaccctgcttgccgcttcacactgtgcagtggcggaggctgctgctgctggccttcctc
ctgtccttagcgtggcccgccagccccctcccccgggaggaggagatcgtgtttccagag
aagctcaatggcagtagcatcctacctggatcaggcgttcctgccaggctgctgtaccga
ttgccagcctttggggagatgttgctactagaactagaacaggaccctggggtgcaggta
gagggtttgactgtacagtacctgggccaggcacctgagatgctgggtggggcagagcca
ggtacctacctgactggcaccatcaatggagatccggagtcggtggcatctctgcactgg
gacgggggagccctattaggggtactgcagtaccgtggggccgaactccacctccagcct
ctggaaggaggcgcccttaactctgctgggggaccgggggctcacatcctacgccggaag
agtcctgccagcagccaaggtcccatgtgcaccgtcaaggctccttctgggagcccgagt
cccatttcccgcagaaccaagcgcttcgcttctctgagtagattcgtggagacactggtg
gtagcagatgacaagatggcagcattccatggtacagggttaaagcgctacctgctgacg
gttatggcagctgccgctaaagcctttaaacacccaagcatccgaaaccctgtcaacttg
gtggtgacgcgcctggtgatcctggggtccggccaggaagggccccaagtggggccaagt
gccgcccagaccctacgcagcttctgcacctggcagcggggcctcaacacccctaacgac
tcagatcctgaccactttgacacagccattctgttcacccggcaggacctgtgtggggtc
tccacttgtgacaccctgggtatggctgatgtgggcacagtgtgtgatccagctaggagc
tgtgctattgtggaagatgatgggctccagtcagccttcactgctgctcatgaactgggc
catgtcttcaacatgctccatgataactccaagccatgcactaacttgaatgggcagggg
ggttcctctcgccatgtcatggctcctgtcatggcccatgtggaccctgaagagccctgg
tcgccctgcagtgcccgattcatcactgacttcctggacaatggttatgggcactgcctc
ttagacaaaccggaggctcccctccatctaccagcgacttttcctggcaaggactatgac
gctgaccgccaatgccaactgaccttcggtcctgactcaagccattgtccacagctgcca
ccgccctgtgctgccctctggtgctctggccacctcaatggccatgccatgtgccagacg
aagcactcaccttgggctgatggcactccctgcgggtcttcacaggcctgcatgggtggc
cgctgtctgcacgtggaccagctcaaggacttcaatgttcctcaggctggaggctggggc
ccctggggaccatggggtgactgctccaggacttgtgggggtggtgtccagttctcctcc
cgggattgcacgaggcccgtcccccggaacggtggcaagtattgtgagggccgccggact
cgcttccgctcctgcaacacggagaactgcccacacggctcagcattgaccttccgtgaa
gagcagtgtgctgcctacaaccaccgaaccgacctcttcaagagctttccagggcccatg
gactgggttccgcgctacacaggtgtggcccctcgagaccaatgcaaactcacctgccag
gcccgggcactgggctactactacgtattggagccccgggtggcagatgggactccctgc
tccccagacacctcctctgtctgtgtccagggccgctgtatccatgctggctgtgaccgg
atcattggctccaaaaagaaatttgacaagtgcatggtgtgcggcggggatggctctcgc
tgcagcaagcagtcgggctccttcaaaaaattcaggtatggatacagcgatgtggtcacg
atccctgcgggggccacccatatccttgtacggcagcagggggggtctggtctcaagagc
atctacctggccctgaagctttctgacggttcttacgccctcaatggtgaatacacgctg
atgccctccccaacagatgtggttcttcctggggcagtcagcttgcgctacagcggagcc
acagcagcctcagagacactgtctggacatgggccgctggcccagcccttgacgctgcaa
gtcctggtggctggcaacccacagaatgcacgtctgcggtacagtttctttgtcccgcgg
ccagtcccttcaacaccacgccctcctccccaagactggctgcaacgcagggcagagata
ctgaagatccttcggaagcgtccctgggcaggccggaaataa

DBGET integrated database retrieval system