KEGG   Mus musculus (mouse): 24110Help
Entry
24110             CDS       T01002                                 

Gene name
Usp18, 1110058H21Rik, AW047653, UBP43, Ubp15
Definition
ubiquitin specific peptidase 18 (EC:3.1.2.-)
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.4.19.12]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     24110 (Usp18)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   24110 (Usp18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
6 F; 6 57.17 cM
AA seq 368 aa AA seqDB search
MGKGFGLLRKPCQSVVAEPQQYSALEEERTMKRKRVLSRDLCSAWDSPHGLVGLHNIGQT
CCLNSLLQVFMMNMDFRMILKRITVPRSAEERKRSVPFQLLLLLEKMQDSRQKAVLPTEL
VQCLQKYNVPLFVQHDAAQLYLTIWNLTKDQITDTDLTERLQGLFTIWTQESLICVGCTA
ESSRRSKLLTLSLPLFDKDAKPLKTLEDALRCFVQPKELASSDMCCESCGEKTPWKQVLK
LTHLPQTLTIHLMRFSARNSRTEKICHSVNFPQSLDFSQVLPTEEDLGDTKEQSEIHYEL
FAVIAHVGMADFGHYCAYIRNPVDGKWFCFNDSHVCWVTWKDVQCTYGNHRYRWRETAYL
LVYTKTGS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggggtttgggctcctgaggaaaccctgccagtcagttgtggctgagccgcag
cagtactcagcgctggaggaagagaggaccatgaagaggaagagagtgctgtctagagac
ctctgcagtgcctgggacagccctcatggtctggttggtttacacaacatcggacagacg
tgttgccttaactccttgcttcaagtgttcatgatgaacatggacttcagaatgatattg
aagaggataacagtgcctcggagtgcagaagagaggaagagaagtgtccccttccagctg
cttttgctgctggagaagatgcaggacagtcgacagaaagccgtgctgcccacggagctc
gttcagtgcctgcagaaatacaacgtgccgttgtttgtccagcacgatgctgctcaactc
taccttacaatctggaacctgactaaggaccagatcacggacacagacttgacagagcgg
ctgcagggtctgttcaccatctggacgcaggagtccctgatttgcgtgggctgtacagca
gagagcagcaggaggagcaaactgctcacactctctcttcctctttttgataaggacgca
aagcctctgaaaaccctggaggatgccttgagatgtttcgtccagcccaaagagttagca
agctccgacatgtgctgcgagagctgtggggagaagacgccttggaaacaggttctgaag
ctgactcatctgccccaaaccttgaccattcacctcatgagattctctgccaggaactcg
aggacggaaaagatctgtcactcagttaatttccctcagagcttggatttcagtcaggtt
ctgccaaccgaggaagacctcggtgataccaaggaacagtctgaaatacactatgaactc
tttgccgtgattgcccacgttgggatggctgactttggtcattactgtgcctacatccgg
aatcccgtggatggaaagtggttctgcttcaatgactcacatgtttgttgggtcacctgg
aaggatgtccagtgtacctatgggaaccacagataccgctggcgggaaacggcctatctc
ttggtttacacgaagactggatcctga

DBGET integrated database retrieval system