KEGG   Mus musculus (mouse): 241274Help
Entry
241274            CDS       T01002                                 

Gene name
Pnpla7, BC027342, E430013P11Rik, Nre
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    241274 (Pnpla7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     241274 (Pnpla7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 A3; 2
AA seq 1352 aa AA seqDB search
MQNEEDACLEAGYCLGTTLSSWRLHFMEEQSQSTMLMGIGIGALLTLAFVGITFFFVYRR
VRRLRRAEPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGNTSAPRQRVRKRTKVLSLA
KRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMVFVQLQEGEHVFQPGEPDISIYVVQDGRLEVCIQDADGTEVVVKEVLPGDSVHS
LLSILDVITGHTAPYKTVSARAAVSSTVLWLPAAAFQGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLLSVASVAGRAKRQMSYGPEEQLERSLRPSEFSSS
DHGSSCVTVSGPLLKRSCSVPLPSNHGEVDELRQSQGSGSNTSAFQESHEGATSDLGMAY
NRARILPHSDEQLGNSLASKSKKSVVAETPSAIFHYSENFRDETGACGKTDAIFRAATKD
LLTLMKLDDPSLLDGRVAFLHVPAGTLVSKQGDQDVNILFVVSGMLHVYQQKIDSLEDTC
LFLTHPGEMVGQLAVLTGEPLMFTIRANRDCSFLSISKAHFYEIMRKRPDVVLGVAHTVV
KRMSSFVRQIDFALDWMEVEAGRAIYRQGDKSDCTYIVLSGRLRSVIRKDDGKKRLAGEY
GRGDLVGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGEKIL
GSLQQGSATGHQLGFNTASSKWDLGNPPGNLSTVAALPASEDVPLTAFALELQHALSAIG
PVLLLTSDNIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADGTLTPWTQRCIRQA
DCILIVGLGEQEPAVGELEQMLESTAVRAQKQLILLHKEDGPVPSRTVEWLNMRSWCSGH
LHLCCPRRVFSKRSLPKLVEMYTRVFQRPPDRHSDFSRLARMLTGNAIALVLGGGGARGC
AQVGILRALAECGVPVDIIGGTSIGAFMGALFAEERSYSQTRIRAKQWAEGMTSMMKTIL
DLTYPITSMFSGTGFNSSISNIFKDRQIEDLWLPYFAITTDITASAMRVHTDGSLWRYVR
ASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSRDETDLTNYG
DALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSDYCEYLRPPIDSY
RTLDFGKFDEICEVGYQHGRTVFDIWVRSGVLEKMLQDQQGTSKRKDCGVFTCPNSSFTD
LAEIVSRIEPAKVAAVDDESDYQTEYEEELPAIPKETYADFQSTGIELDSDSEYEPSMLQ
GPPSLTSPEQSQDSFPWLPNQDDQGPRLEHPS
NT seq 4059 nt NT seq  +upstreamnt  +downstreamnt
atgcagaatgaggaagatgcctgccttgaggctggctactgtttgggtaccaccctgagc
tcctggaggctgcatttcatggaggagcagtcccagtccaccatgctgatggggattgga
attggcgccctccttaccctagccttcgttggtattaccttcttttttgtatacagaaga
gtgagaagattacgacgggcagaacccactcctcagtacaggttccggaagagagacaaa
gtaatgttttatggccggaagatcatgaggaaggtgaccacactcccccataccttggtt
gggaatacctctgcaccccggcagcgagtcaggaagaggaccaaagtgctgtctttagcc
aagaggattctgcgctttaagaaagagtatcccactttgcagccaaaagagcctccgccc
tccctgcttgaggctgatcttacagagtttgatgtgaagaactctcatctgccatcagaa
gtcttgtacatgttgaaaaatgttcgggttctaggccactttgagaagccactatttctg
gaactttgcaaacatatggtctttgtgcagctacaagaaggggagcacgtattccaacct
ggggagcctgacatcagcatctatgtggttcaggacggacggctggaggtctgcatccaa
gacgctgatggcaccgaagtggtggtcaaagaggtcctgccaggggacagtgtccacagt
ctcctcagcattttggatgtgatcaccggtcacactgcaccatacaaaacagtttctgcc
cgtgccgctgtctcgtccaccgtgctctggcttcctgcagcagcttttcaaggagtgttt
gagaaataccctgaaactctggtcagggttgtgcagatcatcatggtccggctgcagcgg
gtgactttcctggctctgcacaactacctggggctgactacagagctcttcaaccctgag
agccaggccatccctctcttgtcagtagcaagtgtggctggacgagccaagagacagatg
tcatatggtccagaggagcagcttgagaggtccctacggccctcggagttcagcagctca
gatcatgggagcagctgtgtgacagtctctgggcctctgctgaagaggagctgctcagtg
cctctgccttctaaccatggggaggtggatgagctcagacagtcccagggaagtggctct
aacacttctgccttccaagaaagccatgagggagccacctcagacctggggatggcatac
aaccgtgccaggattttgccacactctgatgagcaacttgggaactctttggccagcaag
tccaagaaaagtgttgtcgcagagaccccctctgccatcttccactactcagaaaatttc
agggatgagactggggcctgtgggaagacagatgctatcttcagagctgccacaaaggac
ctccttaccctgatgaagctagatgacccatccctgttggatggccgggtggcatttctt
catgttcctgcaggcaccttagtgtcaaaacagggagatcaggatgtcaatattttgttt
gtggtctcggggatgctgcatgtgtaccagcaaaagattgacagcttggaggatacttgc
ctgttcctcacacatcccggggagatggtgggtcagctggcggtgctcactggagaaccc
ctaatgttcaccatcagagccaaccgagactgcagctttttgtccatctcgaaggcccac
ttctatgagatcatgaggaaacggccggatgttgtcctgggcgtggcacacacagttgtg
aagaggatgtcatcctttgtacggcagattgattttgctctagactggatggaagtagag
gctggacgtgccatatacaggcaaggagacaagtctgactgcacatacatcgttctcagt
ggcaggctgcgttctgtcatccgaaaagatgatgggaaaaaacgcctggcaggggaatat
ggccgaggagaccttgttggtgtggtggagacgctgacccaccaggccagagcaaccaca
gtgcatgctgtccgggactcagaactggctaagctgccagcaggagctctgacgtctatc
aagcgcaggtacccacaggttgtaacgcgactgattcatctcttgggcgagaagatctta
ggcagtctccagcagggatctgcaacaggtcaccagcttggatttaacacagcaagcagc
aaatgggacttggggaacccgcctggcaatctgtccacagtggcagcactgcctgcttct
gaggatgtgcccctaaccgcctttgctctggagctccaacatgccctcagtgccatcggt
cctgtcctgctgctgaccagtgacaacatcaaacaacgcctgggttccgctgctctagac
agcatccatgagtaccggctctccagttggctgggccagcaggaggacatccaccggatt
gtgctgtatcaggcagacggcacactcacaccgtggacccagcgctgcatccggcaggct
gactgcatcctcatcgtgggcttgggtgagcaagagccagcagtaggtgagctggagcag
atgttggagagcacagctgtgcgtgcccagaagcagctaatcttgctgcacaaagaggac
ggtccagtgccttcccgcacagtggagtggctcaacatgcgaagttggtgttctggccat
ttgcacctctgctgcccacgccgtgtcttctccaagagaagcttgcccaagctggtcgag
atgtacacacgtgttttccaacgaccaccagaccgtcattctgatttttcccgcctggca
cggatgctgacaggcaatgccattgccttggtgcttggagggggtggagctagagggtgt
gcccaggtgggcatcctcagggcactagcagagtgtggcgtccccgtggacataatcgga
ggcacatccatcggggctttcatgggtgctctgtttgctgaggagcggagctacagccaa
acacggatccgggccaagcagtgggcagagggtatgacatcaatgatgaagactatactg
gacctgacctacccaatcacatccatgttctctggcactggcttcaatagcagcatcagc
aacatcttcaaagaccggcagattgaggacctgtggctcccctactttgccatcaccacc
gacatcacggcctctgccatgcgggttcacacagatggctctctgtggaggtatgtccgt
gcaagcatgtccttgtcaggctatatgcccccactctgcgaccccaaggatggacacctg
ctgatggatggtggttacatcaacaacctcccagcggatgtggcaagatccatgggggca
aaggttgtgattgccatcgatgttggcagccgggacgagacagacctcaccaactatggc
gatgccttgtctggatggtggctgctttggaaacgctggaaccccttggctacaaaagtc
aaggtgttgaacatggcagagattcagactcgactggcctatgtgtgctgcgtccggcag
ctggagatggtgaagaacagcgactactgtgagtacctgaggcctcccatcgacagttac
cgcaccctggacttcggcaaatttgatgagatctgtgaagttgggtatcaacatgggcgg
acagtgtttgacatctgggtccggagtggtgtcctagagaagatgttgcaggaccagcag
gggacaagcaagaggaaggactgtggggtgttcacctgccccaattcctccttcacggac
cttgctgagattgtgtcacggattgagccggccaaggtggctgcagtggatgatgagtct
gactatcagaccgagtatgaggaggaactgccagccatccccaaggaaacgtatgctgac
ttccagagcactgggattgagctagactctgactcggaatatgagccttcgatgttgcaa
ggaccccccagcttgacttccccagaacagtcccaggactccttcccttggctccctaat
caagatgaccaggggccaagactggaacatccttcctga

DBGET integrated database retrieval system