KEGG   Mus musculus (mouse): 241656Help
Entry
241656            CDS       T01002                                 

Gene name
Pak7, 2900083L08Rik, 6430627N20, Pak5
Definition
(RefSeq) p21 protein (Cdc42/Rac)-activated kinase 7 (EC:2.7.11.1)
  KO
K05736  
p21-activated kinase 7 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
ErbB signaling pathway
Ras signaling pathway
Axon guidance
Focal adhesion
T cell receptor signaling pathway
Regulation of actin cytoskeleton
Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    241656 (Pak7)
   04012 ErbB signaling pathway
    241656 (Pak7)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    241656 (Pak7)
  Cellular community
   04510 Focal adhesion
    241656 (Pak7)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    241656 (Pak7)
  Development
   04360 Axon guidance
    241656 (Pak7)
 Human Diseases
  Cancers
   05211 Renal cell carcinoma
    241656 (Pak7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     241656 (Pak7)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   241656 (Pak7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 F3
AA seq 719 aa AA seqDB search
MFGKKKKKIEISGPSNFEHRVHTGFDPQEQKFTGLPQQWHSLLADTANRPKPMVDPSCIT
PIQLAPMKTIVRGNKSCKETSINGLLEDFDNISVTRSNSLRKESPPTPDQGAASRIQGHS
EENGFITFSQYSSESDTTADYTTEKYRDRSLYGDDLDLYYKSSHAAKQNGHAMKMKHGDA
YYPEMKSLKTDLAGFPVDYHTHLDSLRKSSEYGDLRWDYQRASSSSPLDYSFQLTPSRTA
GTSRCSKESLAYSESDWGPSLDDYDRRPKSSYLHQTSPQPAMRQRSKSGSGLQEPMMPFG
ASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVFSPPLSGSDTYPRGPTKLPQS
QSKAGYSSGSHQYPSGYHKASLYHHPSLQTSSQYISTASYLSSLSISSSTYPPPSWGSSS
DQQPSRVSHEQFRAALQLVVSPGDPREYLDNFIKIGEGSTGIVCIATEKHTGKQVAVKKM
DLRKQQRRELLFNEVVIMRDYHHDNVVDMYNSYLVGDELWVVMEFLEGGALTDIVTHTRM
NEEQIATVCLSVLKALSYLHNQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKR
KSLVGTPYWMAPEVISRLPYGTEVDIWSLGIMVIEMIDGEPPYFNEPPLQAMRRIRDSLP
PRVKDLHKVSSMLRGFLDLMLVREPSQRATAQELLGHPFLKLAGPPSCIVPLMRQYRHH
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgtttgggaagaaaaagaaaaagatcgaaatatctggcccatccaactttgaacacagg
gttcatactggatttgatccacaagagcagaagtttactggccttccccagcagtggcac
agcctgttagcagacacagccaacaggcccaagcccatggtggacccatcatgcatcaca
cccatacagctggctcccatgaagacaatcgtcagaggaaataaatcctgcaaggaaacc
tctatcaatggtctgctagaggattttgacaacatctccgtgactcgctccaactctcta
aggaaagaaagcccacccaccccagatcagggagcagctagccgcattcaaggccactcg
gaagagaacggcttcatcactttctcacaatattccagtgaatccgatacgactgcggac
tacacaactgaaaagtacagagacaggagtctctatggagatgacctggatctgtactat
aaaagcagccatgcagccaagcaaaatgggcatgccatgaagatgaaacatggagacgct
tactaccctgagatgaagtctttgaaaaccgacctggccggattccctgtcgactatcac
acccacttggactctctgagaaaatcaagtgaatatggtgaccttaggtgggattatcag
agagcctctagtagctcccctctggactactcattccagctcacgccttctagaactgca
gggaccagcaggtgctccaaggagagtctggcatacagtgaaagtgattggggacccagc
ctggatgactatgacaggaggccaaaatcatcatacctgcatcagacgagccctcagcca
gccatgcgccagagatccaagtccggctcagggcttcaggaacccatgatgccatttgga
gcaagtgcatttaaaactcatcctcaaggacactcgtacaactcctacacctaccctcga
ttgtccgagcccacaatgtgcattccaaaggtggattacgatcgagcacagatggtcttc
agtcctccactgtcagggtccgacacttaccccagaggccccaccaaactacctcaaagt
caaagcaaagcaggctactcttcaggcagccaccagtacccttctgggtaccacaaagca
tctctataccaccatccatccctgcaaaccagttctcagtacatctccaccgcttcttac
ttaagctctctcagtatctcctcgagcacctaccctccacctagctggggctcctcctca
gaccagcagccctcaagggtatcccatgaacaattccgagctgccctgcaactggtggtc
agcccaggagaccccagggaatatttggataactttattaaaatcggagaagggtcgaca
ggcatcgtgtgcattgcaacagagaaacacacaggcaagcaagtggcagtgaagaaaatg
gacctccgaaagcagcagagacgggaactcctttttaatgaggtcgtgataatgcgtgat
taccaccatgacaacgtagttgacatgtacaacagctaccttgttggagatgagctctgg
gtggtcatggagtttctagaaggtggtgccttgacagacattgtcactcataccagaatg
aatgaagagcagatagctactgtctgcctgtcagttctgaaagctctgtcctaccttcat
aaccaaggagtgattcacagggacataaagagtgactccattcttctgacaagcgatggc
cggataaagttatctgactttggtttctgtgctcaagtttccaaagaggtgccaaagagg
aagtcactggtgggtaccccatactggatggcacctgaggtgatttccaggctaccttat
gggacagaggtggacatctggtccctcgggataatggtgatagagatgattgatggggag
cccccctatttcaatgagcctcctctgcaggccatgaggaggatccgggacagtttacct
ccaagagtgaaggacctacacaaggtttcttccatgctccgaggattcctagatcttatg
ttggtgagggagccctctcaaagagccacagctcaagaactccttggacatccattctta
aaattggcaggtccaccatcttgcattgttcctctcatgagacaatacagacatcactga

DBGET integrated database retrieval system