KEGG   Mus musculus (mouse): 243874Help
Entry
243874            CDS       T01002                                 

Gene name
Nlrp9b, Nalp-delta, Nalp9b, Nlrp9
Definition
(RefSeq) NLR family, pyrin domain containing 9B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A3
AA seq 1003 aa AA seqDB search
MAGSSGYGLLKLLQKLSDEEFQRFKELLREEPEKFKLKPISWTKIENSSKESLVTLLNTH
YPGQAWNMMLSLFLQVNREDLSIMAQKKKRHKQTKYKKFMKTTFERIWTLETNTHIPDRN
YHLIVEVQYKALQEIFDSESEPVTAIVAGTTGEGKTTFLRKAMLDWASGVLLQNRFQYVF
FFSVFSLNNTTELSLAELISSTLPESSETVDDILSDPKRILFILDGFDYLKFDLELRTNL
CNDWRKRLPTQIVLSSLLQKIMLPGCSLLLELGQISVPKIRHLLKYPRVITMQGFSERSV
EFYCMSFFDNQRGIEVAENLRNNEVLHLCSNPYLCWMFCSCLKWQFDREEEGYFKAKTDA
AFFTNFMVSAFKSTYAHSPSKQNRARLKTLCTLAVEGMWKELFVFDSEDLRRNGISESDK
AVWLKMQFLQTHGNHTVFYHPTLQSYFAAMFYFLKQDKDICVPVIGSIPQLLGNMYARGQ
TQWLQLGTFLFGLINEQVAALLQPCFGFIQPIYVRQEIICYFKCLGQQECNEKLERSQTL
FSCLRDSQEERFVRQVVDLLEEITVDISSSDVLSVTAYALQKSSKLKKLHLHIQKTVFSE
IYCPDHCKTRTSIGKRRNTAEYWKTLCGIFCNLYVLDLDSCQFNKRAIQDLCNSMSPTPT
VPLTAFKLQSLSCSFMADFGDGSLFHTLLQLPHLKYLNLYGTYLSMDVTEKLCAALRCSA
CRVEELLLGKCGISSKACGIIAISLINSKVKHLSLVENPLKNKGVMSLCEMLKDPSCVLQ
SLMLSYCCLTFIACGHLYEALLSNKHLSLLDLGSNFLEDTGVNLLCEALKDPNCTLKELW
LPGCFLTSQCCEEISAVLICNRNLKTLKLGNNNIQDTGVRQLCEALSHPNCNLECLGLDL
CEFTSDCCKDLALALTTCKTLNSLNLDWKTLDHSGLVVLCEALNHKRCNLKMLGLDKSAF
SEESQTLLQDVEKKNNNLNILHHPWFEAERNKRGTRLVWNSRN
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctcatctggctatggcttgctgaagcttctgcaaaaactgagtgatgaggag
ttccagagatttaaagagcttctcagagaagagcctgaaaagtttaaactcaaaccaata
tcctggacgaaaatcgagaattcttccaaagaaagcctggtaacgctattgaacacacat
tatccaggacaggcatggaatatgatgttaagcctgtttctacaggtcaatcgggaagac
ctctcaatcatggctcagaaaaagaagagacataaacaaactaaatacaaaaagtttatg
aagactacatttgaaaggatatggacattggagaccaacactcatatacctgatagaaac
taccatttaattgtagaagtccagtacaaagcattgcaggaaatatttgattctgagtca
gagccagtcactgcaattgtagcaggtacaacaggagaaggaaaaaccactttcttaaga
aaagcaatgttggattgggcatcaggagttttactgcagaaccggtttcagtatgttttc
ttcttctctgtcttctcacttaacaataccacagagttaagcttagccgagcttatctca
agtacgttgcctgaatcttcagagacagtggatgatattttatctgatccaaaaagaatc
ttgtttatcctggatggatttgattacctgaaatttgacttggaactcaggacaaacttg
tgcaatgactggaggaagaggctgccaacacaaatcgtcttgagtagtttgctacagaaa
ataatgctcccgggatgttctctgcttcttgaattgggacaaataagtgtaccaaaaatc
cgtcatttgctgaagtatccaagggtgataactatgcaaggattctctgagcggtctgta
gagttctattgtatgtccttctttgataaccagagaggcatagaagtagctgagaattta
aggaataatgaagtactccatttatgcagcaatccttatctatgctggatgttctgtagt
tgtttaaagtggcagtttgacagggaggaggaagggtactttaaggctaaaacagatgcg
gctttcttcacaaactttatggtgagtgcattcaaatcaacatatgcccatagtccgtcc
aaacagaacagagcccgattaaagaccctgtgtaccttggctgtagaaggaatgtggaaa
gagttgtttgtctttgactctgaagatctcaggaggaatgggatatctgaatccgataag
gcagtgtggctgaaaatgcaatttctccagactcacggtaaccacactgtgttttatcat
cctacactacagtcatattttgctgccatgttctatttcctcaaacaagacaaagacata
tgtgtcccagtcattggaagcatacctcaacttctaggaaacatgtatgctcgtggccag
acccagtggctccagttaggcacatttttgtttggactcatcaatgaacaagtcgccgcc
ttactccaaccatgctttggctttatacaacccatatatgtaagacaggaaatcatttgt
tactttaagtgtcttggtcaacaagagtgcaatgagaaactggaaagatcccagactttg
ttctcctgtctgcgtgacagccaggaggaaagatttgttagacaagtggtggatctactt
gaagaaattactgttgatattagtagttcagatgtattatcagtgactgcatatgctctg
cagaaatcctccaaattaaagaaacttcatctgcatatacaaaagacagttttttcagaa
atctactgcccagaccattgtaaaacaagaacttctataggcaaaagacgaaatacagcc
gaatattggaaaacattatgtggcattttctgcaacttatatgtgttggatctggacagc
tgtcagttcaataaaagggccatacaggacctctgtaattcgatgtctccaactcctacg
gtgcccctgactgcttttaagctccaaagcttgtcgtgttccttcatggctgactttgga
gatggttcattatttcacacccttcttcagctacctcacctgaaatacctgaacctgtat
ggcacttatctctccatggatgtgactgagaagctgtgtgctgctctgagatgctcagca
tgcagagtggaggagctgctgttgggtaaatgtggcatctcaagtaaggcctgtggcata
attgcgatttcccttatcaactctaaagtgaaacacctctcattggttgaaaatcccttg
aagaacaaaggagtgatgtcactgtgtgaaatgctgaaggatccaagctgtgtcctgcag
tcactgatgttgtcttactgctgcctcacattcattgcctgtggacatctctatgaagca
cttttgagcaacaaacacctctccctgcttgatctgggatcaaatttcctggaagatact
ggagtgaaccttctgtgtgaagctttgaaagatccaaactgcaccctcaaggagttatgg
ttgccgggttgctttttaacttcacaatgctgtgaggagatctcggctgtcctcatttgc
aatagaaatctaaagaccctgaaactgggcaacaataacatacaagacactggtgtcaga
cagttatgtgaagctctgagtcatcccaactgtaacttggagtgtcttgggttagacctg
tgtgagttcaccagtgactgttgtaaggacctagccttggctctcaccacctgcaaaaca
ctgaatagcttaaatctggactggaaaaccttggaccactctgggctggtggtgctctgt
gaggctttgaatcacaaaagatgtaacctgaagatgcttggactggacaaatctgcgttt
tccgaggaatcacagacattactgcaagatgtggaaaagaaaaataataatctgaatatt
ttgcatcatccctggtttgaggcggaacgcaacaagaggggtactcgtctggtatggaac
agcaggaattga

DBGET integrated database retrieval system