KEGG   Mus musculus (mouse): 243881Help
Entry
243881            CDS       T01002                                 

Gene name
Cyp2b23, EG243881
Definition
cytochrome P450, family 2, subfamily b, polypeptide 23
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mmu00140]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mmu00590]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mmu00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mmu05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 A3; 7
AA seq 491 aa AA seqDB search
MEPSVLLLLALLTGFLLLLIRGQPKAYSRLPPGPRPLPFLGNLLQMDRGGLLKSFIKLRD
KHGDVFTVHLGPRPVVMLYGTETIKEALVDHSDAFSGRGAIAVIQPIVQDYGVIFSSGER
WKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYEGAPLDPTFLFQCITANIIC
SIVFGERFDYTDHQFLHLLDLFYQTLSLISSFSSQLFELFSAVLKYFPGTHRQISKNIQE
ILNYIGHSVEQHKATLDPSAPRDFIDTYLLRMEKEKSNHHTEFHHQNLLISVLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAEKVQKEIDQVISAHHVPTLEDRIKMPYTEAVIHEIQRFS
DLAPIGLPHTVTKDTVFRGYLLPKNTEVYPILSSALHDPQYFEQPDKFNPEHFLDANGAL
KKSEAFLPFSTGKRICLGEGIARNELFLFFTALLQNFSLSSPVAPEDIDLTPKESGFVKI
PPVYRICFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagtgtcttgctcctccttgctctcctcacaggcttcttgctactcttgatt
agaggccagccaaaggcatatagccgtcttccaccaggaccccgtcccctgcccttcttg
ggaaacctcttgcagatggacagaggaggcctcctcaagtcttttattaagcttcgtgac
aaacatggcgatgtgttcacagtacacttgggaccaaggcccgtggtcatgctgtatggg
acagagaccataaaggaagctctggtggaccatagtgatgctttctctggccggggagca
attgcagtgattcagccaattgtacaggactatggtgtgatcttttccagtggggaacgt
tggaagacccttcggcgattctctctggccaccatgagagactttgggatgggaaagcgg
agtgtggaggagcggataaaggaagaggcccaatgtttggtggaggaactaaagaaatac
gagggagcccccctggatcccacctttctcttccagtgcatcacagccaatatcatctgc
tccattgtgtttggagagcgctttgactacacagatcaccagttcctgcacctgcttgat
ctgttctatcagaccttgtcacttatcagctcattctccagtcagttgtttgaactcttc
tctgcagtcctgaagtactttcctggcactcacagacaaatttccaaaaacatacaggaa
atcctcaactacattggccatagtgtggagcagcacaaggccaccttggaccccagtgct
ccacgagacttcattgatacctaccttttgcgcatggagaaggagaagtccaaccatcac
acagaattccatcaccagaaccttttgatatctgtgctctctctcttctttgctggcact
gagaccaccagtaccacactccgctatggcttcctgcttatgctcaagtaccctcatgtt
gcagagaaagtccaaaaggagattgatcaggtgatcagtgcacaccatgtcccaaccctt
gaagaccgaatcaaaatgccatacactgaggcggtcatccatgagattcagagattttca
gatctcgccccgattggtctgccacacacagtcaccaaagacacagtgttccgaggatac
ctgctccccaagaacactgaggtgtaccccatcctgagttcagctctccatgacccacag
tactttgaacaaccagacaagttcaatcctgagcacttcctggatgccaatggggcactg
aagaaaagtgaagcttttctgcccttctccacaggaaagcgcatttgtcttggcgaaggc
attgcccgaaacgaattgttccttttcttcactgccctccttcagaacttctcattgtcc
agccccgtggctcctgaagacattgacctgactcccaaggagagtggctttgtcaaaata
cccccagtgtatcggatctgcttcttacctcgctga

DBGET integrated database retrieval system