KEGG   Mus musculus (mouse): 243881Help
Entry
243881            CDS       T01002                                 

Gene name
Cyp2b23, EG243881
Definition
(RefSeq) cytochrome P450, family 2, subfamily b, polypeptide 23
  KO
K07412  cytochrome P450 family 2 subfamily B [EC:1.14.14.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00140  Steroid hormone biosynthesis
mmu00590  Arachidonic acid metabolism
mmu00830  Retinol metabolism
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    243881 (Cyp2b23)
   00590 Arachidonic acid metabolism
    243881 (Cyp2b23)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    243881 (Cyp2b23)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    243881 (Cyp2b23)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     243881 (Cyp2b23)
Cytochrome P450 [BR:mmu00199]
 Cytochrome P450, animal type
  CYP2 family
   243881 (Cyp2b23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 243881
NCBI-ProteinID: NP_001074617
MGI: 3646735
Ensembl: ENSMUSG00000040650
Vega: OTTMUSG00000022527
UniProt: E9Q593
Position
7; 7 A3
AA seq 491 aa AA seqDB search
MEPSVLLLLALLTGFLLLLIRGQPKAYSRLPPGPRPLPFLGNLLQMDRGGLLKSFIKLRD
KHGDVFTVHLGPRPVVMLYGTETIKEALVDHSDAFSGRGAIAVIQPIVQDYGVIFSSGER
WKTLRRFSLATMRDFGMGKRSVEERIKEEAQCLVEELKKYEGAPLDPTFLFQCITANIIC
SIVFGERFDYTDHQFLHLLDLFYQTLSLISSFSSQLFELFSAVLKYFPGTHRQISKNIQE
ILNYIGHSVEQHKATLDPSAPRDFIDTYLLRMEKEKSNHHTEFHHQNLLISVLSLFFAGT
ETTSTTLRYGFLLMLKYPHVAEKVQKEIDQVISAHHVPTLEDRIKMPYTEAVIHEIQRFS
DLAPIGLPHTVTKDTVFRGYLLPKNTEVYPILSSALHDPQYFEQPDKFNPEHFLDANGAL
KKSEAFLPFSTGKRICLGEGIARNELFLFFTALLQNFSLSSPVAPEDIDLTPKESGFVKI
PPVYRICFLPR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggagcccagtgtcttgctcctccttgctctcctcacaggcttcttgctactcttgatt
agaggccagccaaaggcatatagccgtcttccaccaggaccccgtcccctgcccttcttg
ggaaacctcttgcagatggacagaggaggcctcctcaagtcttttattaagcttcgtgac
aaacatggcgatgtgttcacagtacacttgggaccaaggcccgtggtcatgctgtatggg
acagagaccataaaggaagctctggtggaccatagtgatgctttctctggccggggagca
attgcagtgattcagccaattgtacaggactatggtgtgatcttttccagtggggaacgt
tggaagacccttcggcgattctctctggccaccatgagagactttgggatgggaaagcgg
agtgtggaggagcggataaaggaagaggcccaatgtttggtggaggaactaaagaaatac
gagggagcccccctggatcccacctttctcttccagtgcatcacagccaatatcatctgc
tccattgtgtttggagagcgctttgactacacagatcaccagttcctgcacctgcttgat
ctgttctatcagaccttgtcacttatcagctcattctccagtcagttgtttgaactcttc
tctgcagtcctgaagtactttcctggcactcacagacaaatttccaaaaacatacaggaa
atcctcaactacattggccatagtgtggagcagcacaaggccaccttggaccccagtgct
ccacgagacttcattgatacctaccttttgcgcatggagaaggagaagtccaaccatcac
acagaattccatcaccagaaccttttgatatctgtgctctctctcttctttgctggcact
gagaccaccagtaccacactccgctatggcttcctgcttatgctcaagtaccctcatgtt
gcagagaaagtccaaaaggagattgatcaggtgatcagtgcacaccatgtcccaaccctt
gaagaccgaatcaaaatgccatacactgaggcggtcatccatgagattcagagattttca
gatctcgccccgattggtctgccacacacagtcaccaaagacacagtgttccgaggatac
ctgctccccaagaacactgaggtgtaccccatcctgagttcagctctccatgacccacag
tactttgaacaaccagacaagttcaatcctgagcacttcctggatgccaatggggcactg
aagaaaagtgaagcttttctgcccttctccacaggaaagcgcatttgtcttggcgaaggc
attgcccgaaacgaattgttccttttcttcactgccctccttcagaacttctcattgtcc
agccccgtggctcctgaagacattgacctgactcccaaggagagtggctttgtcaaaata
cccccagtgtatcggatctgcttcttacctcgctga

DBGET integrated database retrieval system