KEGG   Mus musculus (mouse): 244349Help
Entry
244349            CDS       T01002                                 

Gene name
Kat6a, 1500036M03, 9930021N24Rik, MOZ, Myst3, Zfp220
Definition
K(lysine) acetyltransferase 6A (EC:2.3.1.48)
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     244349 (Kat6a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A2; 8
AA seq 2003 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRRTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDTKQSVDWNKLLKRAFEGLAETGGSTLKS
IERFLKSQKDVSAACGGSAAPGFHQQLRLAIKRAVGHGRLLKDGPLYRLNTKAASAEGKE
GCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKQPEELVSCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYANPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITVSSQSASSSEEGYLERIDGLDFCRDSNAPLKFNKKTKGLIDGLTKFFTPSP
DGRKARGEVVDYSEQYRIRKKGNRKSSTSDWPTDNQDGWESKQENEERLFGSQEIMTERD
MELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLCE
FCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLFL
DHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGRF
LIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLTG
VCPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVIV
SNSVVSEDEDEEADEGEKEEPQGQERELETRVKVGKSVSREKKDQESSSLIETDKKPEVK
ELASSSRLSKQALPRDSLPANSQPPRRGRCGRKNRKTQERFGDKDSKMLVDETLSASQEQ
YGDCEEKSETSQERFTEMEEQLAAPQVQADGKPDIPKGRFSESVELWRGQLKKSPETLKC
RLPEGNDRLPCCYTDGDRAVFRGFSESSEEEEEPESPRSNSPPILTKPTLKRKKPILHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEMEEEEEEEEEESEL
FPRGYFHCLSSQDILRCQSSSKRPSKEEEEEEEESDDADDTPVLKPVSLLRKCDVNSASL
EPDTSTPMKKKKGWPKGKSRKPIHWKKRPGRKPGFKLNQEIIAASAQECIVEPVVPIKPG
RKPRTQENEEIVEVKEDLLEERKEEMHTEPDEEAEEEEDTTSSDIRAMSPLDSSNSPEAE
PKEPEPEEEDEKPSDDQRQSEEEPQELEEQEQEEEDEVTTEANQNEDHDADDEDEGHLDS
LKTKEPEEQPAREDDKEEPGIQGSFLAANMQDSRENTKDKDEAEPDSEEDQPSHEASVVS
ETMPGSEEDHEEDSNTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHEGAYQDC
EETLAACQTLQSYTHTDEDPQMSMVEDCHASEHNSPISSIPSHPSQSVRSVNSPSMPALE
SGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTTENYENP
SSYDSTMGSSICGNNSSQSSCSYGGLSSSSSLTQNSCVVTQQMANMGNSCSMLQQNTVQP
AANCNIKSPQTCVVERPPSNQQPPPPPPPPPPPQQPQPPPQQQAAPQPPPPQPQQQQQQQ
QQPPPPQQQPQPPPPQQQPPLSQCSMNNSFTAAPMIMEIPESGSTGNISIYERIPGDFGA
GSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHPLA
GTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRSKS
APLPSATAHQQQLYGRSPPAVAMQAGPRALAVQRGMNMGVNLMPTPAYNVNSMNMNTLNA
MNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYTGP
SHHSYMNAAGVPKQSLNGPYMRR
NT seq 6012 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgctaacccgctgtacacggagtggattttggaggccatcaaaaaagtc
aagaagcagaaacagcgaccttcagaggaaaggatctgcaatgccgtgtcctcatcccat
gggctggaccgcaggactgtgctagagcagctggagctgagcgtcaaagacgggacgatt
ttaaaggtctcaaacaaaggtctcaattcctacaaagatcctgataatcctgggcgaata
gcacttcctaaacctcggaaccatggaaaattggatactaagcaaagtgtggattggaat
aaattactcaagcgggcatttgagggcttggcagagactggtggctcaactttgaaaagt
atcgaacgttttttgaaaagccagaaggatgtatctgctgcctgtggaggtagtgctgcc
cctgggtttcaccagcagctacgattggccatcaagcgtgctgttggtcatggccgactc
ctcaaagatggacccctctaccgcctcaacactaaggcagccagtgctgaagggaaagag
ggctgtgagtcgctctcgtgtttacctcccgtgtcactgcttccacacgagaaagacaag
ccggttgctgaaccaatccccatctgtagcttctgtcttggtacaaaagagcagaaccgg
gagaagcagcccgaggaactcgtctcctgcgcggactgcggcaatagcggtcatccatcg
tgtttaaagttctccccagagctaacagtgagagtgaaggccttacggtggcagtgcatt
gagtgtaaaacatgcagctcctgtcgtgaccaaggcaaaaacgcagataacatgctcttt
tgtgactcatgtgaccgaggttttcacatggagtgttgtgacccaccacttacacggatg
ccaaaaggtatgtggatatgtcagatatgccgacctaggaaaaaaggacggaaacttcta
caaaagaaggcggcacagataaaacggcgctatgctaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtccctttagcaaagttcgaactggtcct
ggaaggggtcggaaacgtaaaatcactgtctccagccagtctgcatcatcatcagaagaa
ggctatttagagcggatagatggcttggacttctgcagagatagcaatgcccccttgaag
ttcaacaagaaaaccaaagggctcattgatggccttaccaaattcttcaccccttctcct
gatgggcggaaagcccgaggggaagtggtagactactctgagcaatacagaatcaggaaa
aagggcaacaggaaatcaagtacttcagattggcccacagacaatcaggacggctgggaa
agcaaacaagaaaatgaggaacggctttttgggagccaagaaatcatgactgaaagagat
atggaattgtttcgtgatatccaagaacaagcactgcagaaggtcggagtaactgggccc
cctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaatccacacc
tggtattcctctccgtaccctcaggagtactcaaggctgcctaaattgtatctttgtgag
ttctgtctaaaatatatgaaaagtagaactattctacagcagcacatgaagaaatgtggt
tggttccatcctcctgccaatgagatttaccgaaagaataatatttctgtctttgaggtt
gatgggaacgtgagtaccatttattgtcaaaatctgtgtctcttggcaaagttgtttctt
gaccacaaaacactctattatgacgtggagccatttcttttctatgttctaacacagaat
gatgtcaagggctgccaccttgttggctacttttctaaagaaaagcactgccaacagaaa
tacaatgtctcctgtataatgattcttccccaataccaacgtaagggctacggcaggttt
ctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcaggctctcctgagaaa
ccattatcagatctaggtcgtctctcctacatggcttactggaagagtgtgatcctggag
tgcctttatcaccaaaatgacaagcagatcagcatcaagaagctgagcaagctgactgga
gtctgccctcaggacatcacgtccacactgcaccacctacgaatgctggacttccgcagt
gaccaatttgtgattatccgccgggagaaacttatccaggatcacatggcaaagctgcag
ctgaaccttcggcctgtagatgtagatccagagtgcttacgctggactccagtcatagtc
tccaattctgtggtctccgaggatgaagacgaggaggccgatgagggagagaaagaagag
ccccaaggccaagaaagagagctagagaccagggtaaaggtggggaagtctgtgtctcgg
gagaaaaaagatcaggagtcttcctctttaatagaaactgacaagaagccagaagttaag
gaactagccagttcttcacgtttgagcaaacaggcccttcctcgggacagtcttcctgca
aatagccagccacctcggaggggccgctgtgggaggaagaacagaaagacacaagaacgc
tttggtgataaagattctaagatgcttgtggatgagacactatccgcttctcaagagcaa
tatggagactgcgaggaaaagtcagaaacctcccaagaacggttcactgagatggaagag
cagttggcagcccctcaagtgcaagcagacgggaaaccagacatccccaaggggaggttc
agtgagagcgttgagttgtggcgaggacagctgaagaaaagccctgagaccctgaagtgc
cgattgccagaaggaaatgaccggcttccgtgctgctacaccgatggtgacagggctgtc
tttaggggcttcagcgagagcagtgaggaggaggaagagccagagagtccccggtcaaac
tcgccaccaattctcacgaagcccacactgaaaagaaagaaaccgattcttcaccgaaga
cgaagagtccgcaagcggaaacaccacaatagcagtgtagtcacagagaccatctctgag
accacggaggtgttagatgagccttttgaagactctgactctgagagaccaatgccacga
ctggagcctacatttgagatggaggaagaggaggaggaggaggaggaggagagtgagctc
ttccccagagggtacttccattgcctgtcctcacaggacatccttaggtgtcagtcctcc
tccaagaggccgtctaaagaggaagaggaggaggaggaggagtcagacgacgcagatgac
actcctgtcctaaagccagtatctctcttgcgaaaatgtgatgtgaacagtgcttcactt
gagccagatacctctacacctatgaaaaagaaaaagggatggcccaaaggcaagagccga
aaacctatccactggaagaaaaggcctggacggaaaccaggatttaaattgaatcaggaa
atcatagctgcttctgcacaggaatgcatagttgagcccgtagtccccattaaaccaggc
cgtaaacccagaactcaagagaatgaagaaattgttgaggtaaaggaggacttgctggaa
gaaaggaaagaagagatgcacacagaaccagatgaggaggccgaagaggaagaggataca
accagcagtgacattagagccatgtccccattggacagcagcaacagccctgaggcagaa
ccaaaagaacccgagccagaggaggaagacgagaagccttcggacgatcagaggcagtca
gaggaagagccccaagagctggaggagcaggagcaggaggaagaagatgaagtgaccaca
gaggccaaccagaacgaagaccatgacgctgacgatgaggacgaaggccacctggattcg
ctaaagacaaaagagccagaggagcagccagctagagaagacgacaaggaggagcctggc
atccagggatcttttttagctgcaaacatgcaggacagtagggagaatacaaaggataaa
gatgaggctgaaccggattctgaggaagaccagccttcccatgaggcttctgtggtatca
gaaaccatgccaggctcagaggaggaccatgaggaagactccaacactaaggaagagtta
attgagctaaaggaggaggaagagatcccacacagcgaactggacctggagactgtacag
gcagtgcaatctttgactcaagaagaaagcagtgagcatgaaggagcctaccaggactgt
gaagaaactcttgcagcctgccagacactgcagagttacacccacactgatgaggacccc
cagatgtcaatggttgaagactgtcatgcttcagagcataatagcccgatatcctccatt
ccgtctcatcctagccagtcagtccgctctgtcaacagccccagcatgcctgccctggag
agtggctacacacagatcagcccagagcaaggatccctgtccgcaccctctatgcagaac
atggagaccagccccatgatggatgtgccttccgtatcagaccactctcagcaggtggta
gacagcggcttcagtgatctgggcagcatcgagagtaccacagagaactatgagaaccca
agcagctatgattccaccatgggcagcagcatttgtgggaataattcctctcagagcagc
tgctcgtatggcggcctgtcgtcttcaagcagcctcacccagaacagttgtgttgttact
cagcaaatggccaacatgggcaacagctgcagcatgctgcaacagaacactgtccaacca
gccgccaactgcaatatcaagtcaccgcagacttgtgtggtggaaaggcctcccagtaac
cagcagccacccccgccaccacccccgccgccaccaccacagcagccgcagccgccgcca
cagcaacaggcggccccacagcctcccccaccacagccgcagcagcagcagcagcaacag
cagcagccccctccaccacagcagcagccccagccccctccaccacagcagcagccccct
ctgtctcagtgcagtatgaacaacagcttcactgcagcccccatgataatggagataccc
gagtctggaagcactgggaatatcagtatctacgagaggattccaggggattttggtgca
ggcagctactcccaaccatcagccaccttcagtctagccaagctgcagcagctgaccaac
accatcatggaccctcatgccatgccttacagtcattctccggctgtgacttcctatgca
accagtgtttctctgtccaacacgggactggctcagctagctccatctcatcccttagcc
gggacccctcaagcacaagccaccatgactccacccccaaatctggcgtctactactatg
aacctcacgtcacctctgctacagtgcaacatgtctgccaccaacatcggaattcctcac
actcagaggttgcaagggcagatgccagtcaaggggcacatttctatccgttccaagtct
gcacctttaccctctgcaactgcacaccaacagcagctatatggccgcagcccaccagca
gttgccatgcaggctggccctcgtgcattggctgttcagcgtggcatgaacatgggggtt
aatttaatgcccactccagcctataatgtcaattccatgaatatgaacaccttgaatgcc
atgaacagttatcgaatgacacagcccatgatgaacagcagttaccatagtaaccctgcc
tacatgaaccagacagcacagtatcctatgcagatgcagatggggatgatgggaagccag
gcctatacccagcagcctatgcagccaaaccctcacgggaacatgatgtacactggcccc
tcccatcacagctacatgaatgctgctggcgtgcccaagcagtcacttaacggaccttac
atgaggagatga

DBGET integrated database retrieval system