KEGG   Mus musculus (mouse): 244646Help
Entry
244646            CDS       T01002                                 

Gene name
Pkd1l3
Definition
(RefSeq) polycystic kidney disease 1 like 3
  KO
K04989  
polycystin 1L3
Organism
mmu  Mus musculus (mouse)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    244646 (Pkd1l3)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPP (Polycystin)
   244646 (Pkd1l3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8; 8 A
AA seq 2191 aa AA seqDB search
MLLQRRSWLWLYIRIGVILGDILGRKPSIREQHGGNSCYQLNRLFCDFQEADNYCHAQRG
RLAHTWNPKLRGFLKSFLNEETVWWVRGNLTLPGSHPGINQTGGDDVLRNQKPGECPSVV
THSNAVFSRWNLCIEKHHFICQAAAFPPQGASIWRNEFGPGPLLPMKRRGAETERHMIPG
NGPPLAMCHQPAPPELFETLCFPIDPASSAPPKATHRMTITSLTGRPQVTSDTLASSSPP
QGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPA
SSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQGT
LDTPSSSSPPQGTSDTPASSSPPQGTSETPASNSPPQGTSETPGFSSPPQVTTATLVSSS
PPQVTSETPASSSPTQVTSETPASSSPTQVTSDTPASNSPPQGTSDTPGFSSPTQVTTAT
LVSSSPPQVTSDTPASSSPPQVTSDTPASSSPPQVTSETPASSSPPQVTSDTSASISPPQ
VISDTPASSSPPQVTSETPASSSPTNMTSDTPASSSPTNMTSDTPASSSPTNMTSDTPAS
SSPPWPVITEVTRPESTIPAGRSLANITSKAQEDSPLGVISTHPQMSFQSSTSQALDETA
GERVPTIPDFQAHSEFQKACAILQRLRDFLPTSPTSAQVSVANLLIDLSEQLLVLPFQKN
NSWSSQTPAVSCPFQPLGRLTTTEKSSHQMAQQDMEQVEDMLETSLMALGEIHRAFCQQS
LCPQSAVTLASPSATLMLSSQNVSTLPLSTYTLGEPAPLTLGFPSAEALKELLNKHPGVN
LQVTGLAFNPFKTLDDKNIVGSIGNVQLSSAYQSIRVHDLIEDIEIMLWRNASMETQPTS
LNTSTDHFTISVNITSLEKTLIVTIEPESPLLMTLHLGFQDQLAHTHFYLNISLPRDQVW
QKDEEYTWVLTPENLWYGTGTYYIMAVENKSTEAAQHTPVLVSVVTAVTQCYFWDRYNRT
WKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIKLLLHVTNNPVGVSLL
SSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYRRRAATTAKVV
ITLYGSEGHSEPHHLCDPEKTVFERGALDVFLLSTGSWLGDLHGLRLWHDNSGDSPSWYV
SQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLFSSTIVEKFTQ
DYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRGTEQLGPLAVT
LSELLVSIQTSIILFPIHLIFGRLFQLIHPPEALPQLPFIQAAWPPALVCESPSLTQVVK
ELKETVGFLLRRNTQLLSECEPSSCSSCDINKLAKLLSGLIYCHLEDEGCHQQTESHWED
AVSENHYHFCRYLLQLLRRLKAHLEALGATQDHQSCDFSEAVSQLQNLQELLETQTLRRG
PGPCRHSTSFPILSPGEGKKPMSFCLFRWLKCSCWLLLGVISLASAFFITLYSLELDKDQ
ATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHARRIVALWAKCP
WSAPGLRDKNNPIYTAPAMNNLAKPTRKAWKKQLSKLTGGTLVQILFLTLLMTTVYSAKD
SSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTLLPNLYGDYRGFITDGNSFLLGNVLI
RQTRIPNDIFFPGSLHKQMKSPPQHQEDRENYGAGWVPPDTNITKVDSIWHYQNQESLGG
YPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEFTVFNANVNLL
CAVTLILESSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYYAFIQGCRLKR
QRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFISFYEALRVNS
AVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEVLGFILIIVVLLSSYAMTFN
LLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLLVLSSIILMGLVIINLF
VSAILIAFGKERKACEKEATLTDMLLQKLSSLLGIRLHQNPSEEHADNTGSSNLRERSSK
SMSSDAEVLAPADAVGSVSGTDGNSGSTKVL
NT seq 6576 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgcagaggcggtcctggctctggctgtacattagaatcggtgtcattctgggt
gatattttgggacgtaaaccaagcatccgggagcaacatgggggaaacagctgctatcag
cttaacagacttttctgtgacttccaggaagcagataactactgccacgcccagagagga
cgcctagcccacacgtggaaccccaagcttcggggtttcctaaaaagcttcctgaatgaa
gaaacagtgtggtgggtcaggggaaacctgacgctgcccggatcgcatccagggataaat
cagacaggaggtgatgacgtcttaaggaaccaaaagcctggcgagtgcccttccgtggtc
acacactctaatgctgtcttctcaagatggaacctgtgcatagagaagcatcatttcatt
tgccaggctgccgcctttccccctcaaggtgcaagcatttggagaaatgagtttggtcct
ggtcctctgttacccatgaaaagaagaggagctgagacagagagacatatgatcccagga
aatggccccccgttagccatgtgtcaccaacccgctcctcctgagctttttgagacattg
tgctttcccattgacccagcttcttcagcacctccaaaagccacacacaggatgacaatc
acatccctaactggaaggccacaggtgacatcagacacacttgcatccagcagcccacca
caggggacatcagacacacctgcatccagcagcccaccacaggtgacatcagccacatct
gcatctagcagcccaccacaggggacatcagacacacctgcatccagcagcccaccacag
gtgacatcagccacatctgcatctagcagcccaccacaggggacatcagacacacctgca
tccagcagcccaccacaggtgacatcagccacatctgcatctagcagcccaccacagggg
acatcagacacacctgcatccagcagcccaccacaggtgacatcagccacatctgcatct
agcagcccaccacaggggacatcagacacacctgcatccagcagcccaccacaggggaca
ttagacacaccttcatctagcagcccaccacaggggacatcagacacacctgcatccagc
agcccaccacaggggacatcagagacacctgcatccaacagcccaccacaggggacatca
gagacacctggattcagcagcccaccacaggtgacaacagccacacttgtatccagcagc
ccaccacaggtgacatcagagacacctgcatccagcagcccaacacaggtgacatcagag
acacctgcatccagcagcccaacacaggtgacatcagacacacctgcatccaatagccca
ccacaggggacatcagacacacctggattcagcagcccaacacaggtgacaacagccaca
cttgtatccagcagcccaccacaggtgacatcagacacacctgcatccagcagcccacca
caggtgacatcagacacacctgcatccagcagcccaccacaggtgacatcagagacacct
gcatccagcagcccaccacaggtgacatcagacacatctgcatccatcagcccaccacag
gtaatatcagacacacctgcatccagcagcccaccacaggtgacatcagagacacctgca
tccagcagcccaacaaacatgacatcagacacacctgcatccagcagcccaacaaacatg
acatcagacacacctgcatccagcagcccaacaaacatgacatcagacacacctgcatcc
agcagcccaccatggcctgttataacagaggtcaccaggcctgaatccacaatacctgct
ggaagatctttggcaaacatcacttcaaaggcacaggaagactctcccctgggagtcatc
tctacccatccacagatgtcatttcagagttcaaccagtcaggccttggatgagacagca
ggggaacgggtcccaacaattcctgatttccaagcccacagtgaattccagaaagcttgt
gccatcctccagagactgagagacttcctgccgacttctcccacatcagctcaggtcagt
gtggccaatttactcattgacctgagtgagcagttgctggtgctcccgtttcagaagaac
aacagttggagctctcaaactccagcagtcagctgccccttccagcctcttggacgtcta
acaacaacggaaaaaagcagtcatcagatggctcagcaagacatggaacaggttgaagac
atgctggagacatccctgatggccctgggggagatccacagagcattttgccagcagagt
ctgtgccctcagtcagcagtgaccctggcctctccctctgctactctgatgttgagcagc
caaaatgtgtcaacgttgcccctgagcacctacactttgggtgagcctgcacccttgact
ttgggcttcccgtcagcagaagctctgaaggagctcttgaacaaacacccaggcgtgaac
cttcaagtgacaggtctggctttcaacccttttaagactttggatgacaagaacattgtt
ggaagcattggaaatgtgcagctgagctctgcttatcagtcgatcagagtccacgactta
atagaagatattgagatcatgctctggagaaatgccagcatggagacccagcccaccagc
ctcaacacaagtacagaccatttcacaatctctgtgaacatcacttccttggagaagacc
ctcattgtgaccatcgagcctgaaagtcccctcctaatgacgctccacttgggcttccag
gaccagctggcccacactcacttctatctcaacatcagcctgccaagggaccaagtgtgg
cagaaagatgaggagtacacgtgggtgctgacaccagagaacctgtggtacgggactggc
acctactacataatggctgtggagaataaaagtacagaggcggcacagcacacacccgtc
ctggtctcagtggtcacagctgtcacccagtgctatttctgggaccgatacaataggaca
tggaagagcgatggatgccaagtggggccgaagagcaccattttaaagacacagtgtctc
tgtgaccacctgaccttcttcagcagcgacttcttcatcgtgccgaggacggtggatgta
gaaaacaccatcaaactgcttcttcatgtgaccaacaaccctgtcggggtgtcattgctg
tccagcctcctaggattctatatcctcttagccatgtgggcttccagaaaggatcgagaa
gatatgcagaaggtgaaggtaacagtcctggctgacaatgaccccagctctgcatcccac
taccttatccaggtctacactggctatcggaggagggctgctaccaccgccaaggtcgtt
atcactctctatggctcagaggggcacagtgagccccaccacctttgtgaccctgagaag
acagtttttgagcgtggagcactggatgttttccttctttccaccggatcctggctgggg
gacctgcatggccttcggctgtggcatgacaattctggcgacagcccttcttggtatgta
agccaggtgatcgtcagtgacatgaccacgaggaagaaatggcatttccagtgcaattgt
tggctggccgtggacttgggcaactgtgagcgtgacagggtgttcacaccagcctccaga
agcgagctctcttccttcagacacctgttctcctccacaatcgtagaaaagttcacccag
gattatctgtggctctcagttgcaactcgacatccctggaaccagtttacacgagtccag
aggctctcctgctgcatggcactactgctctgtgacatggtcatcaatattatgttctgg
aagatgggtggcaccactgccaagaggggcaccgaacaactaggtccacttgctgtgacc
ttgtcggagctgctcgtcagcatccagacctccatcatcctcttccccatccacctcatc
tttgggcggctcttccagttgattcacccaccagaagctctgccccagcttcctttcatc
caggctgcctggccccctgctcttgtttgtgagtccccctctcttacacaggtggtcaag
gaattaaaggaaactgtgggattcctgctcaggagaaatacacagctgctctcggagtgt
gagccgtcttcgtgcagttcttgtgacattaacaagctggcgaagcttttatccggcctc
atttactgtcacttagaagacgaaggctgtcaccagcagacagaatcccactgggaagac
gcagtgtctgaaaaccattaccatttctgccgctaccttctccaacttctgcggagactg
aaagcgcatttagaggctcttggtgctacccaggatcaccagtcttgtgatttctcagaa
gcagtcagccaacttcaaaacctccaggaactcctggagacacagactctccgcagaggg
ccagggccatgcaggcattccaccagtttccccatcctcagcccaggagaagggaagaag
cccatgtcattttgcctgttcagatggttgaagtgcagctgctggctccttcttggtgtc
atcagcctggcctcggccttttttataacgctctatagcttggagttggacaaagaccaa
gccaccagctgggttatttcaatgatgctgtcggtactacaagacatctttatcagccag
ccgataaaggtcatcttcctgacattgttgttctccctgatggcaaaccacatgccgtgg
cttaacaaagacaaggaacaacacgcccggagaatcgtagcactttgggcaaagtgtcct
tggtcggcacctggcttgagagacaagaacaatcccatctacactgccccagcaatgaac
aacctagccaagcctacaaggaaggcctggaagaagcagctctccaagctgacgggtggt
actctggtgcaaatcctcttcctgaccctgctgatgactaccgtctattctgcaaaggac
tctagtcgatttttcctccatcgagctatctggaagaggttttctcaccgtttctcagaa
atcaaaactgtagaggatttctacccctgggccaacggcaccctccttcctaacctatat
ggggattacagaggatttattactgacgggaactcctttcttctgggcaatgttttgatc
cgccagactcgcattcctaatgacatattcttcccaggatctctccacaagcaaatgaag
tcgcctccccaacatcaggaggacagagagaactatggggctggctgggtcccccctgac
acaaacatcacaaaagtagacagtatttggcattatcagaatcaggagtcgctgggaggc
tatcccatccaaggggagctagccacttactcaggaggaggctatgttgtgaggcttgga
agaaaccacagtgcggcaaccagggttctgcagcatctggaacagaggcgctggctggac
cactgcacaaaagccctctttgtagaattcacggtcttcaatgctaatgtgaatctgctc
tgtgcggtgaccctcatcttggaatccagtggtgtggggactttcctcacctccctgcaa
ctggacagtttaacttcccttcagtcatcagagaggggcttcgcctggatcgtctcacag
gtcgtctactaccttctcgtctgttactatgccttcatccagggctgtcggctgaagcgg
cagaggctggcgttcttcactaggaaaaggaacctcctggacacaagcatcgtcctcatt
agcttcagcatcctgggcctcagcatgcagagcctctctctacttcacaaaaagatgcag
cagtaccactgtgaccgggacaggttcatcagtttctacgaggcactgagagtgaactct
gcagtcacccacctcaggggcttcctgcttctcttcgcaactgtgcgggtctgggaccta
ctgcgacatcatgcccagttacaggtcatcaacaagacactgtccaaagcctgggacgag
gtgctgggctttatactgatcatcgtggtcctgttaagcagctatgccatgactttcaac
ctgctgtttggatggagcatctctgactaccagagcttcttcagatctatagtgactgtt
gttggcctcttgatgggaacttcaaagcacaaggaggttattgctctatacccaatcctg
ggctcccttttggttctcagtagcatcatcttgatgggacttgtgatcattaatcttttt
gtttctgccattctcattgcctttgggaaagaaaggaaggcctgtgagaaagaagctaca
ctgacagatatgttactacaaaagctctcaagtctgttaggaatccgcctgcaccagaat
ccatctgaggaacacgctgacaacactggttcctcaaatctccgggaaagatcatcaaag
tctatgtcttctgatgctgaggtgctggctccagcagatgcagttggaagtgtgtctggc
accgatggcaactctggcagtacaaaggtgttgtaa

DBGET integrated database retrieval system