KEGG   Mus musculus (mouse): 244646Help
Entry
244646            CDS       T01002                                 

Gene name
Pkd1l3
Definition
(RefSeq) polycystic kidney disease 1 like 3
  KO
K04989  polycystin 1L3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    244646 (Pkd1l3)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPP (Polycystin)
   244646 (Pkd1l3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PKD_channel PLAT GPS Ion_trans Lectin_C
Motif
Other DBs
NCBI-GeneID: 244646
NCBI-ProteinID: NP_001034789
MGI: 2664670
Ensembl: ENSMUSG00000048827
Vega: OTTMUSG00000061919
UniProt: Q2EG98
Position
8; 8 D3
AA seq 2201 aa AA seqDB search
MLLQRRSWLWLYIRIGVILGDILGRKPSIREQHGGNSCYQLNRLFCDFQEADNYCHAQRG
RLAHTWNPKLRGFLKSFLNEETVWWVRGNLTLPGSHPGINQTGGDDVLRNQKPGECPSVV
THSNAVFSRWNLCIEKHHFICQAAAFPPQGASIWRNEFGPGPLLPMKRRGAETERHMIPG
NGPPLAMCHQPAPPELFETLCFPIDPASSAPPKATHRMTITSLTGRPQVTSDTLASSSPP
QGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPA
SSSPPQVTSATSASSSPPQGTSDTPASSSPPQVTSATSASSSPPQGTSDTPASSSPPQGT
LDTPSSSSPPQGTSDTPASSSPPQGTSETPASNSPPQGTSETPGFSSPPQVTTATLVSSS
PPQVTSETPASSSPTQVTSETPASSSPTQVTSDTPASNSPPQGTSDTPGFSSPTQVTTAT
LVSSSPPQVTSDTPASSSPPQVTSDTPASSSPPQVTSETPASSSPPQVTSDTSASISPPQ
VISDTPASSSPPQVTSETPASSSPTNMTSDTPASSSPTNMTSDTPASSSPTNMTSDTPAS
SSPPWPVITEVTRPESTIPAGRSLANITSKAQEDSPLGVISTHPQMSFQSSTSQALDETA
GERVPTIPDFQAHSEFQKACAILQRLRDFLPTSPTSAQKNNSWSSQTPAVSCPFQPLGRL
TTTEKSSHQMAQQDMEQHPMDGAHNAFGISAGGSEIQSDIQLRSEFEVEDMLETSLMALG
EIHRAFCQQSLCPQSAVTLASPSATLMLSSQNVSTLPLSTYTLGEPAPLTLGFPSAEALK
ELLNKHPGVNLQVTGLAFNPFKTLDDKNIVGSIGNVQLSSAYQSIRVHDLIEDIEIMLWR
NASMETQPTSLNTSTDHFTISVNITSLEKTLIVTIEPESPLLMTLHLGFQDQLAHTHFYL
NISLPRDQVWQKDEEYTWVLTPENLWYGTGTYYIMAVENKSTEAAQHTPVLVSVVTAVTQ
CYFWDRYNRTWKSDGCQVGPKSTILKTQCLCDHLTFFSSDFFIVPRTVDVENTIKLLLHV
TNNPVGVSLLSSLLGFYILLAMWASRKDREDMQKVKVTVLADNDPSSASHYLIQVYTGYR
RRAATTAKVVITLYGSEGHSEPHHLCDPEKTVFERGALDVFLLSTGSWLGDLHGLRLWHD
NSGDSPSWYVSQVIVSDMTTRKKWHFQCNCWLAVDLGNCERDRVFTPASRSELSSFRHLF
SSTIVEKFTQDYLWLSVATRHPWNQFTRVQRLSCCMALLLCDMVINIMFWKMGGTTAKRG
TEQLGPLAVTLSELLVSIQTSIILFPIHLIFGRLFQLIHPPEALPQLPFIQAAWPPALVC
ESPSLTQVVKELKETVGFLLRRNTQLLSECEPSSCSSCDINKLAKLLSGLIYCHLEDEGC
HQQTESHWEDAVSENHYHFCRYLLQLLRRLKAHLEALGATQDHQSCDFSEAVSQLQNLQE
LLETQTLRRGPGPCRHSTSFPILSPGEGKKPMSFCLFRWLKCSCWLLLGVISLASAFFIT
LYSLELDKDQATSWVISMMLSVLQDIFISQPIKVIFLTLLFSLMANHMPWLNKDKEQHAR
RIVALWAKCPWSAPGLRDKNNPIYTAPAMNNLAKPTRKAWKKQLSKLTGGTLVQILFLTL
LMTTVYSAKDSSRFFLHRAIWKRFSHRFSEIKTVEDFYPWANGTLLPNLYGDYRGFITDG
NSFLLGNVLIRQTRIPNDIFFPGSLHKQMKSPPQHQEDRENYGAGWVPPDTNITKVDSIW
HYQNQESLGGYPIQGELATYSGGGYVVRLGRNHSAATRVLQHLEQRRWLDHCTKALFVEF
TVFNANVNLLCAVTLILESSGVGTFLTSLQLDSLTSLQSSERGFAWIVSQVVYYLLVCYY
AFIQGCRLKRQRLAFFTRKRNLLDTSIVLISFSILGLSMQSLSLLHKKMQQYHCDRDRFI
SFYEALRVNSAVTHLRGFLLLFATVRVWDLLRHHAQLQVINKTLSKAWDEVLGFILIIVV
LLSSYAMTFNLLFGWSISDYQSFFRSIVTVVGLLMGTSKHKEVIALYPILGSLLVLSSII
LMGLVIINLFVSAILIAFGKERKACEKEATLTDMLLQKLSSLLGIRLHQNPSEEHADNTG
SSNLRERSSKSMSSDAEVLAPADAVGSVSGTDGNSGSTKVL
NT seq 6606 nt NT seq  +upstreamnt  +downstreamnt
atgctcttgcagaggcggtcctggctctggctgtacattagaatcggtgtcattctgggt
gatattttgggacgtaaaccaagcatccgggagcaacatgggggaaacagctgctatcag
cttaacagacttttctgtgacttccaggaagcagataactactgccacgcccagagagga
cgcctagcccacacgtggaaccccaagcttcggggtttcctaaaaagcttcctgaatgaa
gaaacagtgtggtgggtcaggggaaacctgacgctgcccggatcgcatccagggataaat
cagacaggaggtgatgacgtcttaaggaaccaaaagcctggcgagtgcccttccgtggtc
acacactctaatgctgtcttctcaagatggaacctgtgcatagagaagcatcatttcatt
tgccaggctgccgcctttccccctcaaggtgcaagcatttggagaaatgagtttggtcct
ggtcctctgttacccatgaaaagaagaggagctgagacagagagacatatgatcccagga
aatggccccccgttagccatgtgtcaccaacccgctcctcctgagctttttgagacattg
tgctttcccattgacccagcttcttcagcacctccaaaagccacacacaggatgacaatc
acatccctaactggaaggccacaggtgacatcagacacacttgcatccagcagcccacca
caggggacatcagacacacctgcatccagcagcccaccacaggtgacatcagccacatct
gcatctagcagcccaccacaggggacatcagacacacctgcatccagcagcccaccacag
gtgacatcagccacatctgcatctagcagcccaccacaggggacatcagacacacctgca
tccagcagcccaccacaggtgacatcagccacatctgcatctagcagcccaccacagggg
acatcagacacacctgcatccagcagcccaccacaggtgacatcagccacatctgcatct
agcagcccaccacaggggacatcagacacacctgcatccagcagcccaccacaggggaca
ttagacacaccttcatctagcagcccaccacaggggacatcagacacacctgcatccagc
agcccaccacaggggacatcagagacacctgcatccaacagcccaccacaggggacatca
gagacacctggattcagcagcccaccacaggtgacaacagccacacttgtatccagcagc
ccaccacaggtgacatcagagacacctgcatccagcagcccaacacaggtgacatcagag
acacctgcatccagcagcccaacacaggtgacatcagacacacctgcatccaatagccca
ccacaggggacatcagacacacctggattcagcagcccaacacaggtgacaacagccaca
cttgtatccagcagcccaccacaggtgacatcagacacacctgcatccagcagcccacca
caggtgacatcagacacacctgcatccagcagcccaccacaggtgacatcagagacacct
gcatccagcagcccaccacaggtgacatcagacacatctgcatccatcagcccaccacag
gtaatatcagacacacctgcatccagcagcccaccacaggtgacatcagagacacctgca
tccagcagcccaacaaacatgacatcagacacacctgcatccagcagcccaacaaacatg
acatcagacacacctgcatccagcagcccaacaaacatgacatcagacacacctgcatcc
agcagcccaccatggcctgttataacagaggtcaccaggcctgaatccacaatacctgct
ggaagatctttggcaaacatcacttcaaaggcacaggaagactctcccctgggagtcatc
tctacccatccacagatgtcatttcagagttcaaccagtcaggccttggatgagacagca
ggggaacgggtcccaacaattcctgatttccaagcccacagtgaattccagaaagcttgt
gccatcctccagagactgagagacttcctgccgacttctcccacatcagctcagaagaac
aacagttggagctctcaaactccagcagtcagctgccccttccagcctcttggacgtcta
acaacaacggaaaaaagcagtcatcagatggctcagcaagacatggaacagcaccccatg
gacggagcacacaatgcatttgggatcagtgcagggggatcggaaattcaaagtgacatc
cagctacggagtgagtttgaggttgaagacatgctggagacatccctgatggccctgggg
gagatccacagagcattttgccagcagagtctgtgccctcagtcagcagtgaccctggcc
tctccctctgctactctgatgttgagcagccaaaatgtgtcaacgttgcccctgagcacc
tacactttgggtgagcctgcacccttgactttgggcttcccgtcagcagaagctctgaag
gagctcttgaacaaacacccaggcgtgaaccttcaagtgacaggtctggctttcaaccct
tttaagactttggatgacaagaacattgttggaagcattggaaatgtgcagctgagctct
gcttatcagtcgatcagagtccacgacttaatagaagatattgagatcatgctctggaga
aatgccagcatggagacccagcccaccagcctcaacacaagtacagaccatttcacaatc
tctgtgaacatcacttccttggagaagaccctcattgtgaccatcgagcctgaaagtccc
ctcctaatgacgctccacttgggcttccaggaccagctggcccacactcacttctatctc
aacatcagcctgccaagggaccaagtgtggcagaaagatgaggagtacacgtgggtgctg
acaccagagaacctgtggtacgggactggcacctactacataatggctgtggagaataaa
agtacagaggcggcacagcacacacccgtcctggtctcagtggtcacagctgtcacccag
tgctatttctgggaccgatacaataggacatggaagagcgatggatgccaagtggggccg
aagagcaccattttaaagacacagtgtctctgtgaccacctgaccttcttcagcagcgac
ttcttcatcgtgccgaggacggtggatgtagaaaacaccatcaaactgcttcttcatgtg
accaacaaccctgtcggggtgtcattgctgtccagcctcctaggattctatatcctctta
gccatgtgggcttccagaaaggatcgagaagatatgcagaaggtgaaggtaacagtcctg
gctgacaatgaccccagctctgcatcccactaccttatccaggtctacactggctatcgg
aggagggctgctaccaccgccaaggtcgttatcactctctatggctcagaggggcacagt
gagccccaccacctttgtgaccctgagaagacagtttttgagcgtggagcactggatgtt
ttccttctttccaccggatcctggctgggggacctgcatggccttcggctgtggcatgac
aattctggcgacagcccttcttggtatgtaagccaggtgatcgtcagtgacatgaccacg
aggaagaaatggcatttccagtgcaattgttggctggccgtggacttgggcaactgtgag
cgtgacagggtgttcacaccagcctccagaagcgagctctcttccttcagacacctgttc
tcctccacaatcgtagaaaagttcacccaggattatctgtggctctcagttgcaactcga
catccctggaaccagtttacacgagtccagaggctctcctgctgcatggcactactgctc
tgtgacatggtcatcaatattatgttctggaagatgggtggcaccactgccaagaggggc
accgaacaactaggtccacttgctgtgaccttgtcggagctgctcgtcagcatccagacc
tccatcatcctcttccccatccacctcatctttgggcggctcttccagttgattcaccca
ccagaagctctgccccagcttcctttcatccaggctgcctggccccctgctcttgtttgt
gagtccccctctcttacacaggtggtcaaggaattaaaggaaactgtgggattcctgctc
aggagaaatacacagctgctctcggagtgtgagccgtcttcgtgcagttcttgtgacatt
aacaagctggcgaagcttttatccggcctcatttactgtcacttagaagacgaaggctgt
caccagcagacagaatcccactgggaagacgcagtgtctgaaaaccattaccatttctgc
cgctaccttctccaacttctgcggagactgaaagcgcatttagaggctcttggtgctacc
caggatcaccagtcttgtgatttctcagaagcagtcagccaacttcaaaacctccaggaa
ctcctggagacacagactctccgcagagggccagggccatgcaggcattccaccagtttc
cccatcctcagcccaggagaagggaagaagcccatgtcattttgcctgttcagatggttg
aagtgcagctgctggctccttcttggtgtcatcagcctggcctcggccttttttataacg
ctctatagcttggagttggacaaagaccaagccaccagctgggttatttcaatgatgctg
tcggtactacaagacatctttatcagccagccgataaaggtcatcttcctgacattgttg
ttctccctgatggcaaaccacatgccgtggcttaacaaagacaaggaacaacacgcccgg
agaatcgtagcactttgggcaaagtgtccttggtcggcacctggcttgagagacaagaac
aatcccatctacactgccccagcaatgaacaacctagccaagcctacaaggaaggcctgg
aagaagcagctctccaagctgacgggtggtactctggtgcaaatcctcttcctgaccctg
ctgatgactaccgtctattctgcaaaggactctagtcgatttttcctccatcgagctatc
tggaagaggttttctcaccgtttctcagaaatcaaaactgtagaggatttctacccctgg
gccaacggcaccctccttcctaacctatatggggattacagaggatttattactgacggg
aactcctttcttctgggcaatgttttgatccgccagactcgcattcctaatgacatattc
ttcccaggatctctccacaagcaaatgaagtcgcctccccaacatcaggaggacagagag
aactatggggctggctgggtcccccctgacacaaacatcacaaaagtagacagtatttgg
cattatcagaatcaggagtcgctgggaggctatcccatccaaggggagctagccacttac
tcaggaggaggctatgttgtgaggcttggaagaaaccacagtgcggcaaccagggttctg
cagcatctggaacagaggcgctggctggaccactgcacaaaagccctctttgtagaattc
acggtcttcaatgctaatgtgaatctgctctgtgcggtgaccctcatcttggaatccagt
ggtgtggggactttcctcacctccctgcaactggacagtttaacttcccttcagtcatca
gagaggggcttcgcctggatcgtctcacaggtcgtctactaccttctcgtctgttactat
gccttcatccagggctgtcggctgaagcggcagaggctggcgttcttcactaggaaaagg
aacctcctggacacaagcatcgtcctcattagcttcagcatcctgggcctcagcatgcag
agcctctctctacttcacaaaaagatgcagcagtaccactgtgaccgggacaggttcatc
agtttctacgaggcactgagagtgaactctgcagtcacccacctcaggggcttcctgctt
ctcttcgcaactgtgcgggtctgggacctactgcgacatcatgcccagttacaggtcatc
aacaagacactgtccaaagcctgggacgaggtgctgggctttatactgatcatcgtggtc
ctgttaagcagctatgccatgactttcaacctgctgtttggatggagcatctctgactac
cagagcttcttcagatctatagtgactgttgttggcctcttgatgggaacttcaaagcac
aaggaggttattgctctatacccaatcctgggctcccttttggttctcagtagcatcatc
ttgatgggacttgtgatcattaatctttttgtttctgccattctcattgcctttgggaaa
gaaaggaaggcctgtgagaaagaagctacactgacagatatgttactacaaaagctctca
agtctgttaggaatccgcctgcaccagaatccatctgaggaacacgctgacaacactggt
tcctcaaatctccgggaaagatcatcaaagtctatgtcttctgatgctgaggtgctggct
ccagcagatgcagttggaagtgtgtctggcaccgatggcaactctggcagtacaaaggtg
ttgtaa

DBGET integrated database retrieval system