KEGG   Mus musculus (mouse): 246313Help
Entry
246313            CDS       T01002                                 

Gene name
Prokr2, B830005M06Rik, EG-VEGRF2, Gpcr73l1, Gpr73l1, PKR2
Definition
(RefSeq) prokineticin receptor 2
  KO
K08380  
prokineticin receptor 2
Organism
mmu  Mus musculus (mouse)
Brite
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Gut peptide
   Prokineticin
    246313 (Prokr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 F2
AA seq 381 aa AA seqDB search
MGPQNRNTSFAPDLNPPQDHVSLNYSYGDYDLPLGEDEDVTKTQTFFAAKIVIGVALAGI
MLVCGIGNFVFIAALARYKKLRNLTNLLIANLAISDFLVAIVCCPFEMDYYVVRQLSWAH
GHVLCASVNYLRTVSLYVSTNALLAIAIDRYLAIVHPLKPRMNYQTASFLIALVWMVSIL
IAVPSAYFTTETILVIVKNQEKIFCGQIWSVDQQLYYKSYFLFVFGLEFVGPVVTMTLCY
ARISQELWFKAVPGFQTEQIRKRLRCRRKTVLLLMGILTAYVLCWAPFYGFTIVRDFFPT
VVVKEKHYLTAFYVVECIAMSNSMINTICFVTVKNNTMKYFKKMLRLHWRPSHYGSKSSA
DLDLKTSGVPATEEVDCIRLK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgggaccccagaacagaaacactagctttgcaccagacttgaatccaccccaagaccat
gtctccttaaactacagttatggtgattatgacctccccctgggtgaggatgaggatgtg
accaagacacagaccttctttgcagccaaaattgtcattggcgtggcactggcaggcatc
atgctggtctgcggcattggcaactttgtcttcattgctgccctcgcccgctacaagaag
ctgcgcaaccttaccaacctcctcattgctaacctggccatctctgacttcctggtggcg
atcgtctgctgcccctttgagatggactattatgtagtacggcagctttcctgggcgcat
ggtcacgtgctttgtgcctccgtcaactaccttcgtacggtctccctgtacgtctccacc
aacgctctgctggccatcgctattgacagatacctcgctattgtccaccctttgaaacca
cggatgaattatcagaccgcttccttcctgatcgctttggtctggatggtctccatcctc
atcgctgtcccatctgcctacttcaccacagaaaccatcctcgttatcgtcaagaatcaa
gaaaaaatcttctgtggtcagatctggtcggtggaccagcagctctactacaaatcctac
ttcctcttcgtcttcgggcttgagttcgtgggtcccgtggtcactatgaccctgtgctat
gccaggatctcccaagagctctggttcaaggctgtacctggcttccagacggagcaaatc
cgcaagcggctgcgttgccgccgcaagacagtgctactgctcatgggcatcctcacagcc
tacgtgctgtgctgggcgccgttctatggctttaccatagtgcgagacttcttccccacg
gtagttgtgaaggagaagcactacctcaccgccttctacgtcgtggagtgcattgccatg
agcaacagcatgatcaatactatatgcttcgtgacggtcaagaacaacaccatgaaatac
ttcaagaagatgctgcggctccactggcggccctctcactacgggagtaagtccagcgct
gacctcgacctcaaaaccagcggggtgcctgccactgaagaggtggattgtatcagacta
aagtag

DBGET integrated database retrieval system