KEGG   Mus musculus (mouse): 246787Help
Entry
246787            CDS       T01002                                 

Gene name
Slc5a2, Sglt2
Definition
(RefSeq) solute carrier family 5 (sodium/glucose cotransporter), member 2
  KO
K14382  
solute carrier family 5 (sodium/glucose cotransporter), member 2
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC5: Sodium glucose cotransporter
   246787 (Slc5a2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   246787 (Slc5a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 F4
AA seq 670 aa AA seqDB search
MEQHVEAGSELGEQKVLIDNPADILVIAAYFLLVIGVGLWSMFRTNRGTVGGYFLAGRSM
VWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFVPVYLTAGV
ITMPQYLRKRFGGHRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIALL
GITMIYTVTGGLAALMYTDTVQTFVILAGAFILTGYAFHEVGGYSGLFDKYLGAMTSLTV
SKDPSVGNISSTCYQPRPDSYHLLRDPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQRCL
AGKNLTHIKAGCILCGYLKLMPMFLMVMPGMISRILYPDEVACVVPEVCKRVCGTEVGCS
NIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDKEL
LLVGRLWVVFIVAVSVAWLPVVQAAQGGQLFDYIQSVSSYLAPPVSAVFVLALFVPRVNE
KGAFWGLVGGLLMGLARLIPEFFFGSGSCVRPSACPALFCRVHYLYFAIILFICSGILTL
GISLCTAPIPQKHLHRLVFSLRHSKEEREDLDADELEGPAPAPVQNGGQECAMEMEEVQS
PAPGLLRRCLLWFCGMSKSGSGSPPPTTEEVAATTRRLEDISEDPRWARVVNLNALLMMT
VAVFLWGFYA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacacgtagaggcaggctctgaacttggggagcagaaggtcctgattgataat
cctgctgacattctggttatcgctgcctatttcctgctggtcattggtgttggcttgtgg
tctatgttcagaaccaatagaggcacagttggtggctacttcctggcaggacggagcatg
gtgtggtggccggttggagcctctctgttcgccagcaacatcggcagcggtcattttgtg
ggcctggcagggactggcgcagcaagtggcttggcggtggctggatttgagtggaatgcg
ctcttcgtggtgctgctcctcggatggctttttgtgccagtgtatctgaccgctggtgtg
atcacaatgcctcagtacctccgcaagcgctttggtgggcaccgtattcgcctctacctg
tccgtgctctcgctttttttgtacattttcaccaagatctcggtggatatgttctctggg
gcagtattcattcaacaggccctgggctggaacatttacgcttcggtcatcgctctcttg
ggcatcaccatgatttatactgtgacaggagggctggcggcactgatgtacacagacact
gtgcagaccttcgtcattcttgccggggccttcatcctcactggttatgctttccatgaa
gtgggcgggtactcgggtctcttcgacaaatacctgggagcaatgacttcactgacggtg
tccaaggatccatctgttggcaacatctccagcacctgctaccagccgaggcctgactcc
tatcacctgctgcgtgaccctgtgacaggagacctgccatggcctgcgctgctcctgggg
cttaccattgtctcgggctggtattggtgcagcgatcaggtaatagtgcagcggtgcctg
gctggaaagaatctgactcacatcaaagctgggtgcatcttgtgtggctacctgaagctg
atgcccatgttcctcatggtcatgccaggcatgatcagccgcattctctacccagatgag
gtggcatgtgtggtacctgaggtgtgtaagcgggtgtgtggcactgaggtgggctgctct
aacatcgcctacccacggctcgtggtgaagctcatgcccaatggtctgcgcggactcatg
ctggcagtcatgctggctgccctcatgtcttctctggcatccatctttaacagcagtagc
acgctcttcaccatggatatctacacgcgcctgcggccccgtgcaggtgataaggagctg
ctgctagttggaaggctctgggtggtattcatcgtggcggtgtccgtggcttggctgcca
gtggtgcaggcagctcagggtgggcagctcttcgattacattcagtctgtctccagctat
ctggcacctccagtgtctgcggtctttgtgcttgcactctttgtgccccgtgttaatgag
aagggagccttctggggactagttgggggcctgctgatgggcctagctcgtctcataccc
gagttcttctttggctcgggcagctgtgtgcgaccctcagcgtgcccggcactcttctgt
cgggtacactacctctatttcgccatcattctcttcatctgctctggcatcctcacactt
ggaatctccctgtgcactgcgcccatccctcagaagcatctccatcgcctggttttcagt
ctccggcacagcaaggaggagcgggaggacctggatgctgatgagttagaaggtccagcc
cctgctcctgtgcagaacgggggccaggaatgtgcaatggagatggaagaggtccagtcc
ccggctccaggcctgctccgccggtgcctgctttggttctgtgggatgagcaagagtggg
tcagggagtcctccgcccactaccgaggaggtggcggcaaccaccaggcggctggaggac
atcagtgaggatccccgctgggcacgagtagtcaacctcaatgccctactcatgatgacc
gtggctgtgttcctctggggcttctatgcataa

DBGET integrated database retrieval system