KEGG   Mus musculus (mouse): 252870Help
Entry
252870            CDS       T01002                                 

Gene name
Usp7, 2210010O09Rik, AA409944, AA617399, AU019296, AW548146, C80752, Hausp
Definition
ubiquitin specific peptidase 7 (EC:3.4.19.12)
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mmu05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mmu05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mmu05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
16 A1; 16
AA seq 1103 aa AA seqDB search
MNHQQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVTLSDGHSNAEEDM
EDDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFL
QCNAESDSTSWSCHAQAVLKIINYRDDDKSFSRRISHLFFHKENDWGFSNFMAWSEVTDP
EKGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLR
KAVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQEL
CRVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKN
IFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNI
KINDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCK
FDDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQ
LVERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVRYTVFKVLKN
SSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWT
IFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSE
LPTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQF
FKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWL
NSQFREEEITLYPDKHGCVRDLLEECKKAVELGDKASGRLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEIPLDQVDIDKENEMLITVAHFHKEVFGTFGIPFLLRIHQGEHFRE
VMKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGL
DHFNKAPKRSRYTYLEKAIKIHN
NT seq 3312 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccaacagcagcagcagcagcagcagaaagcgggcgagcagcagctgagcgag
cccgaggacatggagatggaagctggagatacagatgacccaccaagaattactcagaac
cctgtcatcaatgggaatgtaaccctgagtgatgggcacagcaacgcagaagaggacatg
gaggatgacaccagttggcgctccgaggcaacctttcagttcactgtcgagcgcttcagc
agactgagtgagtcggtccttagccctccgtgttttgtgcgaaatctgccatggaagatt
atggtgatgccacgcttttatccagacagaccacaccaaaaaagcgtaggattctttctc
cagtgcaatgctgaatctgactccacgtcgtggtcctgccacgcacaagcagtgctgaag
ataataaattacagggatgatgacaaatcattcagccggcgaatcagccacttgttcttc
cacaaggaaaacgactggggattctctaatttcatggcctggagtgaagtgactgatcct
gagaaaggattcatcgatgatgacaaagtcacctttgaagtttttgtacaggcagatgct
ccccatggagttgcgtgggactcaaagaagcatactggctatgtcggcttaaagaatcag
ggagcaacgtgttacatgaatagcttgctgcagaccttgtttttcacaaatcagttacga
aaggctgtgtacatgatgccaacagagggcgatgattcatctaaaagcgtccctttagca
ttacaaagagtgttctatgaattacagcacagcgataagcccgtaggaacaaaaaagctc
acaaagtcatttgggtgggaaactttagatagcttcatgcaacacgatgttcaagagctt
tgtcgagtgttgcttgataatgtggaaaataagatgaaaggcacctgtgtagagggcacc
attccaaagttattccgaggcaaaatggtgtcctatattcagtgcaaagacgtagactac
cgttctgataggagagaagattattatgatatccagctaagtataaaaggaaagaaaaac
atatttgaatcatttgtggattatgtggcagtagaacaactagacggtgacaataaatac
gatgctggggagcatggcctgcaggaggcagagaaaggtgtgaaattcctaacattgccc
ccagtgttacacctgcaacttatgaggttcatgtatgaccctcagacggaccaaaacatc
aagatcaatgacaggtttgagtttccagaacagttaccacttgatgaatttttgcaaaaa
acagaccctaaggaccctgcaaattatattctccatgcagtcttggttcacagtggagat
aatcatggtggacattacgtggtttacctaaaccccaaaggggatggcaaatggtgtaag
ttcgatgatgacgtggtatccaggtgtactaaagaagaagccattgagcacaattatggg
ggtcatgatgatgatctgtctgttcgacactgcacaaatgcctatatgttagtgtacatc
agggaatcaaagctaagtgaagtgttacaagctgtcaccgaccatgatattcctcagcag
ttggtggaacgattgcaagaagagaaaaggatcgaggctcagaagcggaaggagcggcag
gaagcccatctctacatgcaagtgcagatagttgcagaggaccagttttgtggccaccaa
ggaaatgacatgtacgacgaggagaaagtgaggtacactgtgttcaaggttctgaagaac
tcctccctggccgagtttgttcagagcctctcccagaccatggggtttccacaagatcag
attcgattatggcctatgcaagcaagaagtaatggaacaaagcggcctgcaatgttagat
aatgaagctgacggcaataaaacaatgattgaactgagtgataatgaaaacccttggaca
atattcctggaaacagttgatcctgagctggctgctagtggagcaacattgcccaagttt
gataaagatcatgatgtaatgttatttttgaagatgtatgatcctaaaacccggagcttg
aattactgtggacatatctacacacccatatcctgtaaaatacgtgacttgctcccggtt
atgtgtgacagagcaggatttatccaggatactagccttatcctctatgaggaagttaag
ccgaatttaacagagagaattcaggactatgatgtgtctcttgataaagcccttgatgag
ctgatggatggtgacatcatagtgtttcagaaggatgacccagaaaacgataacagtgag
ctgcccactgctaaagagtatttcagagatctctaccaccgggtcgacgtcatcttctgt
gacaaaacgatccccaatgaccctggatttgtggtcacattatcaaataggatgaactat
tttcaggttgcaaagacagttgcacagaggctcaacacagaccccatgctgctgcagttt
ttcaagtctcaaggttatagggacggccccggtaatcctcttaggcataattacgaaggt
actttaagagatcttctacaattcttcaagccaagacaacctaagaaactttactatcag
caacttaagatgaaaatcacagactttgagaacaggagaagttttaagtgtatatggtta
aacagccaatttagggaagaggaaataacactatacccagacaagcatggctgtgtccgg
gacctgttagaagaatgtaaaaaagccgtggagctcggtgacaaagcatcagggagactt
aggctgctagaaattgtgagctacaaaattattggtgtgcatcaagaagatgaactatta
gaatgcttatctcctgcaacgagtcggacttttagaatagaggaaatacctttggaccag
gtagacatagataaggaaaacgagatgctaatcacagtggcacatttccacaaagaggtg
tttgggacgtttggaattccatttttgctaaggatacaccagggtgagcatttccgagag
gtgatgaagcggatacagagcctgctggacatccaggagaaggagtttgaaaagtttaaa
tttgcaattgtcatgatgggccggcaccagtacatcaatgaagatgagtatgaagtaaat
ttgaaggactttgagccacaacctggtaacatgtctcatcctcggccttggctagggctt
gaccacttcaacaaagccccaaagaggagtcgctacacttacctagaaaaggcaattaaa
atccacaactga

DBGET integrated database retrieval system