KEGG   Mus musculus (mouse): 26385Help
Entry
26385             CDS       T01002                                 

Gene name
Grk6, Gprk6
Definition
(RefSeq) G protein-coupled receptor kinase 6 (EC:2.7.11.16)
  KO
K08291  
G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
mmu  Mus musculus (mouse)
Pathway
Chemokine signaling pathway
Endocytosis
Morphine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    26385 (Grk6)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    26385 (Grk6)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    26385 (Grk6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     26385 (Grk6)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  GRK family [OT]
   26385 (Grk6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13 30.06 cM; 13 B1-3
AA seq 576 aa AA seqDB search
MELENIVANTVLLKAREGGGGNRKGKSKKWRQMLQFPHISQCEELRLSLERDYHSLCERQ
PIGRLLFREFCATRPELTRCTAFLDGVSEYEVTPDEKRKACGRRLMQNFLSHTGPDLIPE
VPRQLVSNCAQRLEQGPCKDLFQELTRLTHEYLSTAPFADYLDSIYFNRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKKLEKKRIKKRKGEAMALNEKQILEK
VNSRFVVSLAYAYETKDALCLVLTLMNGGDLKFHIYHMGQAGFPEARAVFYAAEICCGLE
DLHRERIVYRDLKPENILLDDHGHIRISDLGLAVHVPEGQTIKGRVGTVGYMAPEVVRNE
RYTFSPDWWALGCLLYEMIAGQSPFQQRKKKIKREEVERLVKEVAEEYTDRFSSQARSLC
SQLLSKDPAERLGCRGGGAREVKEHPLFKKLNFKRLGAGMLEPPFKPDPQAIYCKDVLDI
EQFSTVKGVDLEPTDQDFYQKFATGSVSIPWQNEMVETECFQELNVFGLDGSVPPDLDWK
GQPTAPPKKGLLQRLFSRQDCCGNCSDSEEELPTRL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgagaacatcgtagcgaacacggtgctactcaaggcccgggaaggtggtggc
gggaatcgcaaaggcaagagcaagaaatggcgccagatgctgcagttcccccatatcagc
cagtgtgaggagcttcgactcagccttgagcgtgactaccacagcctatgtgagcgccag
cccattgggcgcctgttatttcgtgagttctgtgctacgagacctgagctgacccggtgt
actgccttcctggatggggtgtctgaatatgaggtgacccctgatgagaagcggaaagca
tgtgggcgccgactaatgcagaactttctgagccacacgggtcctgacctcatccctgaa
gttccacggcagctggtgagtaactgtgcccagcggctagagcagggaccctgcaaagac
ctcttccaggagctgacccggctgacccacgagtacctgagcacggccccttttgccgac
tacctcgacagcatctacttcaaccgttttctgcagtggaagtggctggaaaggcaacca
gtgaccaaaaacaccttcaggcagtaccgagtcctgggcaaaggtggctttggggaggta
tgtgcctgccaggtgcgggcaacaggcaagatgtacgcatgcaagaaactggaaaagaag
cggataaagaagcgaaagggggaggccatggctctcaacgagaaacagatcttggagaaa
gtgaacagtaggtttgtagtgagcttagcctacgcctatgagaccaaggatgcactgtgc
ctggtgctgacattgatgaatggaggtgacctaaagttccacatctaccacatgggccag
gctggctttcctgaagcacgtgctgtcttctatgctgctgagatctgctgtggcctggaa
gacctgcaccgggaacgcattgtgtacagggatctaaagccagagaatatccttctggat
gaccatggccacattcggatctcggacctgggactggccgtgcatgtgcctgagggccag
accatcaaaggccgtgtgggcactgtgggctacatggctccagaggtggtgaggaatgag
cgctacacgttcagtcctgactggtgggcgctaggctgcctcctgtacgagatgatcgca
ggtcagtcgcccttccagcagaggaagaagaagataaagcgcgaagaggtggagcggctg
gtcaaggaagtggccgaggagtacacagaccgcttttcctcacaggcgcgctcactctgt
tctcagcttcttagcaaggaccctgctgagcgcctggggtgtcgtggaggtggcgcccgt
gaggtaaaggagcacccccttttcaagaaactgaatttcaagcggctgggagctggcatg
ctagagccaccttttaagcctgatccccaggctatttattgcaaggatgtcctggacatt
gaacagttctctacagttaaaggtgtggatctggagcccacagaccaagacttctaccag
aagtttgccacaggcagtgtgtccatcccctggcagaatgagatggtggagaccgagtgc
ttccaggaactcaatgtctttgggctggatgggtctgttcccccagacctggactggaag
ggccagcccactgcaccccccaagaagggattgctacagagactcttcagtcgccaagat
tgctgtgggaactgcagcgacagtgaggaagagctccccacccgcctctag

DBGET integrated database retrieval system