KEGG   Mus musculus (mouse): 26397Help
Entry
26397             CDS       T01002                                 

Gene name
Map2k3, AW212142, MEK3, MKK3, Prkmk3, mMKK3b
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04218  Cellular senescence
mmu04620  Toll-like receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04714  Thermogenesis
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05145  Toxoplasmosis
mmu05164  Influenza A
mmu05169  Epstein-Barr virus infection
Module
mmu_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    26397 (Map2k3)
   04010 MAPK signaling pathway
    26397 (Map2k3)
   04668 TNF signaling pathway
    26397 (Map2k3)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    26397 (Map2k3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26397 (Map2k3)
   04664 Fc epsilon RI signaling pathway
    26397 (Map2k3)
  Endocrine system
   04912 GnRH signaling pathway
    26397 (Map2k3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26397 (Map2k3)
  Environmental adaptation
   04714 Thermogenesis
    26397 (Map2k3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    26397 (Map2k3)
  Infectious diseases
   05164 Influenza A
    26397 (Map2k3)
   05169 Epstein-Barr virus infection
    26397 (Map2k3)
   05145 Toxoplasmosis
    26397 (Map2k3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26397 (Map2k3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26397 (Map2k3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase RIO1 DUF4344
Motif
Other DBs
NCBI-GeneID: 26397
NCBI-ProteinID: NP_032954
MGI: 1346868
Ensembl: ENSMUSG00000018932
Vega: OTTMUSG00000006341
UniProt: O09110 Q5SWN9
Position
11; 11 B2
AA seq 347 aa AA seqDB search
MESPAASPPASLPQTKGKSKRKKDLRISCVSKPPVSNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLEKNMKIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADQFSPEFVD
FTSQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgccgcgagcccgccggccagcttgcctcagaccaaaggaaaatccaaa
aggaaaaaggacttacggatatcctgcgtgtccaagccacctgtgtccaaccccacaccc
ccccggaacctggactcccggaccttcatcactatcggagacagaaacttcgaagtggag
gctgatgacttggtgaccatctcagagctgggtcgtggagcctatggggtggtagagaaa
gtgcggcatgctcagagtggtaccatcatggctgtcaagcgcatccgggccacagtgaac
acacaggagcagaaacgtctgcttatggacctagacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctatggtgccctcttcagagagggggatgtatggatctgcatg
gagctcatggacacttccctggataagttctaccggaaggtgctggagaagaacatgaaa
attccggaagacatcctgggggagatcgctgtgtctatcgtgcgggccctggagcacctg
catagcaagctgtctgtgatccacagagatgtgaagccatccaatgtcctcatcaacaag
gaagggcatgtgaagatgtgcgactttggcatcagtggctacctggtggactctgtggca
aagacaatggatgctggctgcaagccttacatggcccctgagaggatcaaccctgaactg
aatcagaagggctacaatgtcaagtctgatgtctggagcctcggcatcaccatgatcgag
atggccattctgcgattcccttatgagtcttggggcacaccgttccagcagctgaagcag
gtggtggaggagccatccccacagctcccagcggaccagttctcccctgagtttgtggac
ttcactagccagtgcctaaggaagaaccctgcagagcgcatgagctacctggagctgatg
gaacacccattcttcaccttgcacaaaactaagaagacagacattgctgcctttgtgaag
gagatcctgggagaggattcatag

DBGET integrated database retrieval system