KEGG   Mus musculus (mouse): 26398Help
Entry
26398             CDS       T01002                                 

Gene name
Map2k4, JNKK1, MEK4, MKK4, PRKMK4, Sek1, Serk1
Definition
mitogen-activated protein kinase kinase 4 (EC:2.7.12.2)
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mmu04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mmu04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mmu04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mmu04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mmu04912]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mmu05166]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
Human Diseases; Infectious diseases; Hepatitis B [PATH:mmu05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mmu05169]
Human Diseases; Infectious diseases; Chagas disease (American trypanosomiasis) [PATH:mmu05142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 40.53 cM
AA seq 397 aa AA seqDB search
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLN
PNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHK
PSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS
TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGN
IKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELAT
GRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELL
KHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcggacctccagcttctggccacccggcggtcagcagcatgcagggtaagcgcaaa
gcactgaagttgaattttgcaaatccacctgtcaaatcgacagcacggtttactctgaat
cctaatactacaggagtccagaacccacacatagagagactgagaacacacagcattgag
tcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggacttg
aaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaa
ccaagtgggcagataatggcagttaaaagaattcggtcaactgtggatgaaaaagaacaa
aaacaacttctcatggatttggatgtagtaatgcggagtagtgattgcccatacattgtt
cagttctatggtgcactcttcagagagggcgactgttggatctgtatggagctcatgtct
acctcgttcgataagttttacaaatatgtatatagtgtgttagatgacgttattccggaa
gagatcttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaac
ttgaaaattattcacagagacatcaaaccttccaatattcttctggacagaagtggaaat
ataaagctctgtgatttcggcatcagtggacagcttgtggactctattgccaagacaaga
gatgctgggtgtaggccgtatatggcacctgaaagaatagacccaagtgcatcaagacaa
gggtatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggccaca
ggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaagtggtgaaa
ggagaccctccgcagctgagtaattctgaagaaagggagttctcccccagtttcatcaac
tttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagagcttctg
aaacatccctttattttgatgtatgaagaacgtactgtagaggtcgcatgctatgtttgt
aaaatcctggatcagatgccagccactcccagctcgcccatgtatgtcgactga

DBGET integrated database retrieval system