KEGG   Mus musculus (mouse): 26398Help
Entry
26398             CDS       T01002                                 

Gene name
Map2k4, JNKK1, MEK4, MKK4, PRKMK4, Sek1, Serk1
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Fluid shear stress and atherosclerosis
Module
MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26398 (Map2k4)
   04012 ErbB signaling pathway
    26398 (Map2k4)
   04668 TNF signaling pathway
    26398 (Map2k4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26398 (Map2k4)
   04664 Fc epsilon RI signaling pathway
    26398 (Map2k4)
  Endocrine system
   04912 GnRH signaling pathway
    26398 (Map2k4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    26398 (Map2k4)
  Infectious diseases
   05166 HTLV-I infection
    26398 (Map2k4)
   05164 Influenza A
    26398 (Map2k4)
   05161 Hepatitis B
    26398 (Map2k4)
   05169 Epstein-Barr virus infection
    26398 (Map2k4)
   05142 Chagas disease (American trypanosomiasis)
    26398 (Map2k4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26398 (Map2k4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   26398 (Map2k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 40.53 cM
AA seq 397 aa AA seqDB search
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLN
PNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHK
PSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS
TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGN
IKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELAT
GRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELL
KHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcggacctccagcttctggccacccggcggtcagcagcatgcagggtaagcgcaaa
gcactgaagttgaattttgcaaatccacctgtcaaatcgacagcacggtttactctgaat
cctaatactacaggagtccagaacccacacatagagagactgagaacacacagcattgag
tcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggacttg
aaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaa
ccaagtgggcagataatggcagttaaaagaattcggtcaactgtggatgaaaaagaacaa
aaacaacttctcatggatttggatgtagtaatgcggagtagtgattgcccatacattgtt
cagttctatggtgcactcttcagagagggcgactgttggatctgtatggagctcatgtct
acctcgttcgataagttttacaaatatgtatatagtgtgttagatgacgttattccggaa
gagatcttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaac
ttgaaaattattcacagagacatcaaaccttccaatattcttctggacagaagtggaaat
ataaagctctgtgatttcggcatcagtggacagcttgtggactctattgccaagacaaga
gatgctgggtgtaggccgtatatggcacctgaaagaatagacccaagtgcatcaagacaa
gggtatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggccaca
ggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaagtggtgaaa
ggagaccctccgcagctgagtaattctgaagaaagggagttctcccccagtttcatcaac
tttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagagcttctg
aaacatccctttattttgatgtatgaagaacgtactgtagaggtcgcatgctatgtttgt
aaaatcctggatcagatgccagccactcccagctcgcccatgtatgtcgactga

DBGET integrated database retrieval system