KEGG   Mus musculus (mouse): 26398Help
Entry
26398             CDS       T01002                                 

Gene name
Map2k4, JNKK1, MEK4, MKK4, PRKMK4, Sek1, Serk1
Definition
mitogen-activated protein kinase kinase 4 (EC:2.7.12.2)
Orthology
K04430  
mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
GnRH signaling pathway
Chagas disease (American trypanosomiasis)
Hepatitis B
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26398 (Map2k4)
   04012 ErbB signaling pathway
    26398 (Map2k4)
   04668 TNF signaling pathway
    26398 (Map2k4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26398 (Map2k4)
   04664 Fc epsilon RI signaling pathway
    26398 (Map2k4)
  Endocrine system
   04912 GnRH signaling pathway
    26398 (Map2k4)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    26398 (Map2k4)
   05164 Influenza A
    26398 (Map2k4)
   05161 Hepatitis B
    26398 (Map2k4)
   05169 Epstein-Barr virus infection
    26398 (Map2k4)
   05142 Chagas disease (American trypanosomiasis)
    26398 (Map2k4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26398 (Map2k4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   26398 (Map2k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B3; 11 40.53 cM
AA seq 397 aa AA seqDB search
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLN
PNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHK
PSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS
TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGN
IKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELAT
GRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELL
KHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcggacctccagcttctggccacccggcggtcagcagcatgcagggtaagcgcaaa
gcactgaagttgaattttgcaaatccacctgtcaaatcgacagcacggtttactctgaat
cctaatactacaggagtccagaacccacacatagagagactgagaacacacagcattgag
tcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggacttg
aaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaa
ccaagtgggcagataatggcagttaaaagaattcggtcaactgtggatgaaaaagaacaa
aaacaacttctcatggatttggatgtagtaatgcggagtagtgattgcccatacattgtt
cagttctatggtgcactcttcagagagggcgactgttggatctgtatggagctcatgtct
acctcgttcgataagttttacaaatatgtatatagtgtgttagatgacgttattccggaa
gagatcttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaac
ttgaaaattattcacagagacatcaaaccttccaatattcttctggacagaagtggaaat
ataaagctctgtgatttcggcatcagtggacagcttgtggactctattgccaagacaaga
gatgctgggtgtaggccgtatatggcacctgaaagaatagacccaagtgcatcaagacaa
gggtatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggccaca
ggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaagtggtgaaa
ggagaccctccgcagctgagtaattctgaagaaagggagttctcccccagtttcatcaac
tttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagagcttctg
aaacatccctttattttgatgtatgaagaacgtactgtagaggtcgcatgctatgtttgt
aaaatcctggatcagatgccagccactcccagctcgcccatgtatgtcgactga

DBGET integrated database retrieval system