KEGG   Mus musculus (mouse): 26398Help
Entry
26398             CDS       T01002                                 

Gene name
Map2k4, JNKK1, MEK4, MKK4, PRKMK4, Sek1, Serk1
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04912  GnRH signaling pathway
mmu04926  Relaxin signaling pathway
mmu05142  Chagas disease (American trypanosomiasis)
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05166  HTLV-I infection
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26398 (Map2k4)
   04012 ErbB signaling pathway
    26398 (Map2k4)
   04668 TNF signaling pathway
    26398 (Map2k4)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26398 (Map2k4)
   04664 Fc epsilon RI signaling pathway
    26398 (Map2k4)
  Endocrine system
   04912 GnRH signaling pathway
    26398 (Map2k4)
   04926 Relaxin signaling pathway
    26398 (Map2k4)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    26398 (Map2k4)
  Infectious diseases
   05166 HTLV-I infection
    26398 (Map2k4)
   05164 Influenza A
    26398 (Map2k4)
   05161 Hepatitis B
    26398 (Map2k4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    26398 (Map2k4)
   05169 Epstein-Barr virus infection
    26398 (Map2k4)
   05142 Chagas disease (American trypanosomiasis)
    26398 (Map2k4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26398 (Map2k4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26398 (Map2k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 26398
NCBI-ProteinID: NP_033183
MGI: 1346869
Ensembl: ENSMUSG00000033352
Vega: OTTMUSG00000005905
UniProt: P47809 Q543X6
Position
11 B3; 11 40.53 cM
AA seq 397 aa AA seqDB search
MAAPSPSGGGGSGGGGGTPGPIGPPASGHPAVSSMQGKRKALKLNFANPPVKSTARFTLN
PNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHK
PSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS
TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRSGN
IKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELAT
GRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELL
KHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcggacctccagcttctggccacccggcggtcagcagcatgcagggtaagcgcaaa
gcactgaagttgaattttgcaaatccacctgtcaaatcgacagcacggtttactctgaat
cctaatactacaggagtccagaacccacacatagagagactgagaacacacagcattgag
tcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagaggacttg
aaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtccacaaa
ccaagtgggcagataatggcagttaaaagaattcggtcaactgtggatgaaaaagaacaa
aaacaacttctcatggatttggatgtagtaatgcggagtagtgattgcccatacattgtt
cagttctatggtgcactcttcagagagggcgactgttggatctgtatggagctcatgtct
acctcgttcgataagttttacaaatatgtatatagtgtgttagatgacgttattccggaa
gagatcttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaagaaaac
ttgaaaattattcacagagacatcaaaccttccaatattcttctggacagaagtggaaat
ataaagctctgtgatttcggcatcagtggacagcttgtggactctattgccaagacaaga
gatgctgggtgtaggccgtatatggcacctgaaagaatagacccaagtgcatcaagacaa
gggtatgatgtccgctctgatgtctggagtttggggatcacattgtacgagttggccaca
ggccgatttccttatccaaagtggaatagtgtatttgatcagctaacacaagtggtgaaa
ggagaccctccgcagctgagtaattctgaagaaagggagttctcccccagtttcatcaac
tttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagagcttctg
aaacatccctttattttgatgtatgaagaacgtactgtagaggtcgcatgctatgtttgt
aaaatcctggatcagatgccagccactcccagctcgcccatgtatgtcgactga

DBGET integrated database retrieval system