KEGG   Mus musculus (mouse): 26400Help
Entry
26400             CDS       T01002                                 

Gene name
Map2k7, 5930412N11Rik, JNKK_2, Jnkk2, MAPKK_7, MEK_7, Mapkk7, Mek7, Mkk7, Prkmk7, sek2
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mmu04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:mmu04012]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mmu04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mmu04620]
Organismal Systems; Immune system; T cell receptor signaling pathway [PATH:mmu04660]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mmu04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mmu04912]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:mmu04722]
Organismal Systems; Development; Osteoclast differentiation [PATH:mmu04380]
Human Diseases; Infectious diseases; Influenza A [PATH:mmu05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mmu05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A1.1; 8
AA seq 468 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTESP
RTSGVLSQHHLPFFSGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagccaagctgaagcaggag
aaccgtgaggcccgcaggaggatcgacctcaacttggatatcagcccacagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccagcgagcagccctgcaa
ctcccactggccaacgatgggggcagccgctcaccatcctcagagagctccccacagcac
cctacaccccccacccggccccgccacatgctggggctcccatcaaccttgttcacaccg
cgcagtatggagagcatcgagattgaccagaagctgcaggagatcatgaagcagacaggg
tacctgactatcgggggccagcgttatcaggcagaaatcaatgacttggagaacttgggt
gagatgggcagtggtacctgtggtcaggtgtggaagatgcggttccggaagacaggccac
atcattgctgttaagcaaatgcggcgctctgggaacaaggaagagaataagcgcattttg
atggacctggatgtagtactcaagagccatgactgcccttacatcgttcagtgctttggc
accttcatcaccaacacagacgtctttattgccatggagctcatgggcacatgtgcagag
aagctgaagaaacgaatgcagggccccattccagagcgaatcctgggcaagatgactgtg
gcgattgtgaaagcactgtactatctgaaggagaagcatggcgtcatccatcgcgatgtc
aaaccctccaacatcctgctagatgagcggggccagatcaagctctgtgactttggcatc
agtggccgccttgttgactccaaagccaaaacacggagtgctggctgtgctgcctatatg
gctcccgagcgcatcgaccctccagatcccaccaagcctgactatgacatccgagctgat
gtgtggagcctgggcatctcactggtggagctggcaacaggacagttcccctataagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccactcctgcct
ggtcacatgggcttctcaggggacttccagtcatttgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcactatgag
atactcgaggtggatgtcgcgtcctggtttaaggatgtcatggcgaagaccgagtcccca
aggactagtggagtcctgagtcagcaccatctgcccttcttcagtgggagtctggaggag
tctcccacttccccaccttctcccaagtccttccctctgtcaccagccatccctcaggcc
caggcagagtgggtctcgggcaggtag

DBGET integrated database retrieval system