KEGG   Mus musculus (mouse): 26400Help
Entry
26400             CDS       T01002                                 

Gene name
Map2k7, 5930412N11Rik, JNKK_2, Jnkk2, MAPKK_7, MEK_7, Mapkk7, Mek7, Mkk7, Prkmk7, sek2
Definition
mitogen-activated protein kinase kinase 7 (EC:2.7.12.2)
Orthology
K04431  
mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Protein processing in endoplasmic reticulum
Osteoclast differentiation
Toll-like receptor signaling pathway
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
Influenza A
Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26400 (Map2k7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26400 (Map2k7)
   04012 ErbB signaling pathway
    26400 (Map2k7)
   04668 TNF signaling pathway
    26400 (Map2k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26400 (Map2k7)
   04660 T cell receptor signaling pathway
    26400 (Map2k7)
   04664 Fc epsilon RI signaling pathway
    26400 (Map2k7)
  Endocrine system
   04912 GnRH signaling pathway
    26400 (Map2k7)
  Nervous system
   04722 Neurotrophin signaling pathway
    26400 (Map2k7)
  Development
   04380 Osteoclast differentiation
    26400 (Map2k7)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    26400 (Map2k7)
   05169 Epstein-Barr virus infection
    26400 (Map2k7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26400 (Map2k7)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   26400 (Map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 A1.1; 8
AA seq 468 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTESP
RTSGVLSQHHLPFFSGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagccaagctgaagcaggag
aaccgtgaggcccgcaggaggatcgacctcaacttggatatcagcccacagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccagcgagcagccctgcaa
ctcccactggccaacgatgggggcagccgctcaccatcctcagagagctccccacagcac
cctacaccccccacccggccccgccacatgctggggctcccatcaaccttgttcacaccg
cgcagtatggagagcatcgagattgaccagaagctgcaggagatcatgaagcagacaggg
tacctgactatcgggggccagcgttatcaggcagaaatcaatgacttggagaacttgggt
gagatgggcagtggtacctgtggtcaggtgtggaagatgcggttccggaagacaggccac
atcattgctgttaagcaaatgcggcgctctgggaacaaggaagagaataagcgcattttg
atggacctggatgtagtactcaagagccatgactgcccttacatcgttcagtgctttggc
accttcatcaccaacacagacgtctttattgccatggagctcatgggcacatgtgcagag
aagctgaagaaacgaatgcagggccccattccagagcgaatcctgggcaagatgactgtg
gcgattgtgaaagcactgtactatctgaaggagaagcatggcgtcatccatcgcgatgtc
aaaccctccaacatcctgctagatgagcggggccagatcaagctctgtgactttggcatc
agtggccgccttgttgactccaaagccaaaacacggagtgctggctgtgctgcctatatg
gctcccgagcgcatcgaccctccagatcccaccaagcctgactatgacatccgagctgat
gtgtggagcctgggcatctcactggtggagctggcaacaggacagttcccctataagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccactcctgcct
ggtcacatgggcttctcaggggacttccagtcatttgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcactatgag
atactcgaggtggatgtcgcgtcctggtttaaggatgtcatggcgaagaccgagtcccca
aggactagtggagtcctgagtcagcaccatctgcccttcttcagtgggagtctggaggag
tctcccacttccccaccttctcccaagtccttccctctgtcaccagccatccctcaggcc
caggcagagtgggtctcgggcaggtag

DBGET integrated database retrieval system