KEGG   Mus musculus (mouse): 26400Help
Entry
26400             CDS       T01002                                 

Gene name
Map2k7, 5930412N11Rik, JNKK_2, Jnkk2, MAPKK_7, MEK_7, Mapkk7, Mek7, Mkk7, Prkmk7, sek2
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04380  Osteoclast differentiation
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04912  GnRH signaling pathway
mmu04926  Relaxin signaling pathway
mmu05164  Influenza A
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26400 (Map2k7)
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26400 (Map2k7)
   04012 ErbB signaling pathway
    26400 (Map2k7)
   04668 TNF signaling pathway
    26400 (Map2k7)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    26400 (Map2k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26400 (Map2k7)
   04660 T cell receptor signaling pathway
    26400 (Map2k7)
   04664 Fc epsilon RI signaling pathway
    26400 (Map2k7)
  Endocrine system
   04912 GnRH signaling pathway
    26400 (Map2k7)
   04926 Relaxin signaling pathway
    26400 (Map2k7)
  Nervous system
   04722 Neurotrophin signaling pathway
    26400 (Map2k7)
  Development
   04380 Osteoclast differentiation
    26400 (Map2k7)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    26400 (Map2k7)
  Infectious diseases
   05164 Influenza A
    26400 (Map2k7)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    26400 (Map2k7)
   05169 Epstein-Barr virus infection
    26400 (Map2k7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     26400 (Map2k7)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: STE group
  STE7 family
   26400 (Map2k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 26400
NCBI-ProteinID: NP_001036022
MGI: 1346871
Ensembl: ENSMUSG00000002948
Vega: OTTMUSG00000059344
UniProt: Q8CE90
Position
8; 8 A1.1
AA seq 468 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPTRPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHIIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
GHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKHYEILEVDVASWFKDVMAKTESP
RTSGVLSQHHLPFFSGSLEESPTSPPSPKSFPLSPAIPQAQAEWVSGR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagccaagctgaagcaggag
aaccgtgaggcccgcaggaggatcgacctcaacttggatatcagcccacagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccagcgagcagccctgcaa
ctcccactggccaacgatgggggcagccgctcaccatcctcagagagctccccacagcac
cctacaccccccacccggccccgccacatgctggggctcccatcaaccttgttcacaccg
cgcagtatggagagcatcgagattgaccagaagctgcaggagatcatgaagcagacaggg
tacctgactatcgggggccagcgttatcaggcagaaatcaatgacttggagaacttgggt
gagatgggcagtggtacctgtggtcaggtgtggaagatgcggttccggaagacaggccac
atcattgctgttaagcaaatgcggcgctctgggaacaaggaagagaataagcgcattttg
atggacctggatgtagtactcaagagccatgactgcccttacatcgttcagtgctttggc
accttcatcaccaacacagacgtctttattgccatggagctcatgggcacatgtgcagag
aagctgaagaaacgaatgcagggccccattccagagcgaatcctgggcaagatgactgtg
gcgattgtgaaagcactgtactatctgaaggagaagcatggcgtcatccatcgcgatgtc
aaaccctccaacatcctgctagatgagcggggccagatcaagctctgtgactttggcatc
agtggccgccttgttgactccaaagccaaaacacggagtgctggctgtgctgcctatatg
gctcccgagcgcatcgaccctccagatcccaccaagcctgactatgacatccgagctgat
gtgtggagcctgggcatctcactggtggagctggcaacaggacagttcccctataagaac
tgcaagacggactttgaggtcctcaccaaagtcctacaggaagagcccccactcctgcct
ggtcacatgggcttctcaggggacttccagtcatttgtcaaagactgccttactaaagat
cacaggaagagaccaaagtataataagctacttgaacacagcttcatcaagcactatgag
atactcgaggtggatgtcgcgtcctggtttaaggatgtcatggcgaagaccgagtcccca
aggactagtggagtcctgagtcagcaccatctgcccttcttcagtgggagtctggaggag
tctcccacttccccaccttctcccaagtccttccctctgtcaccagccatccctcaggcc
caggcagagtgggtctcgggcaggtag

DBGET integrated database retrieval system