KEGG   Mus musculus (mouse): 26403Help
Entry
26403             CDS       T01002                                 

Gene name
Map3k11, 2610017K16Rik, Mlk3, PTK1, SPRK
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 11 (EC:2.7.11.25)
  KO
K04419  
mitogen-activated protein kinase kinase kinase 11 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26403 (Map3k11)
 Human Diseases
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    26403 (Map3k11)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26403 (Map3k11)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   26403 (Map3k11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 A; 19 4.34 cM
AA seq 850 aa AA seqDB search
MEPLKNLFLKSPLGSWNGSGSGGGGGTGGVRPEGSPKATAAYANPVWTALFDYEPNGQDE
LALRKGDRVEVLSRDAAISGDEGWWAGQVGGQVGIFPSNYVSRGGGPPPCEVASFQELRL
EEVIGIGGFGKVYRGSWRGELVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIAL
KAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIH
RDLKSNNILLLQPIEGDDMEHKTLKITDFGLAREWHKTTQMSAAGTYAWMAPEVIKASTF
SKGSDVWSFGVLLWELLTGEVPYRGIDCLAVAYGVAVNKLTLPIPSTCPEPFAQLMADCW
AQDPHRRPDFASILQQLEALEAQVLREMPRDSFHSMQEGWKREIQGLFDELRAKEKELLS
REEELTRAAREQRSQAEQLRRREHLLAQWELEVFERELTLLLQQVDRERPHVRRRRGTFK
RSKLRARDGGERISMPLDFKHRITVQASPGLDRRRNVFEVGAGDSPTFPRFRAIQLEPTE
SGQTWGRQSPRRLEDSSNGERRACWAWGPSSPKPGEAQNGRRRSRMDEATWYLDSDDSSP
LGSPSTPPALNGNPPRPSPEPEEPRRAGPTERGNSSGTPKLIQRALLRGTALLASLGLGR
DLQPPGGLSRERGESPTAPPPAQMPSPCPPELPSTPLIRLSQTTPDAHSSPTPGPLLLDL
GVPSGQPSAKSPRREETRGRTVSPPPGISRSAPGTPGTPRSPPLGLISRPRPSPLRSRID
PWSFVSAGPRPSPLPSPQPAPRRAPWTLFPDSDPFWDSPPANPFRGGSQDCRTQTKDMGA
QAPWAPEAGP
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttgaagaacctcttcctcaagagcccgctggggtcatggaacggcagtggc
agtgggggcggcgggggtaccggtggagtccggccggaggggtctccgaaggcaacagca
gcttatgccaatcctgtctggacagccctgttcgactatgagcccaatgggcaggacgaa
ctagccctgaggaagggcgaccgtgtggaggtgctgtccagggatgcagccatctcagga
gatgagggctggtgggcgggccaggtgggtggccaggtgggcatttttccatccaactat
gtatctcggggtggaggcccacccccctgtgaggtggccagcttccaggagctgcgactg
gaggaggtgatcggcatcggtggcttcggcaaggtctaccgtggcagctggcgaggggag
ctggtggctgtgaaggcagcccgacaggaccctgatgaggacatcagtgtaacagctgag
agtgttcgacaggaggcccggctttttgccatgctggcccatcccaacatcattgccctc
aaagctgtgtgcctggaggagccaaacctatgcctggtgatggagtatgcagctggtggg
cctcttagccgggccctggctggtcggcgtgtgcccccccatgtgctggtcaactgggct
gtgcagattgcccgaggaatgcactacctgcactgtgaggctctggtgcctgtgatacac
cgagacctgaagtccaacaacattctgttgctgcagcccatcgagggtgacgacatggaa
cacaagaccctaaagattactgacttcggcctcgcccgagagtggcacaaaaccacccag
atgagtgctgcgggcacctacgcttggatggctcccgaggttatcaaggcctccaccttc
tccaagggcagcgacgtctggagctttggagtgctgctgtgggaactgctgactggggag
gtgccctaccgtggcatcgactgtcttgccgtagcctatggtgtggctgtaaacaagtta
acgttacccatcccatctacctgccctgagccctttgcacaactcatggctgactgctgg
gcacaggacccccaccgcaggcccgacttcgcctccatcctgcagcagttggaagctcta
gaagcgcaggtgctgcgggagatgccacgggactccttccattccatgcaggaaggctgg
aaacgcgagatccagggcctgtttgatgagctgcgggccaaggaaaaggaactactgagc
cgggaggaggaactgacgcgcgctgcacgtgagcagcggtcccaggcggagcagctgcga
cggcgcgagcacctgctggcgcagtgggagctggaggtgttcgagcgcgagctgacgctg
ctactgcagcaggtggaccgagaacggccgcacgtgcgccgccgccggggcaccttcaag
cggagcaaactccgagcaagggacggcggagaacgcatcagcatgcccctggatttcaaa
caccgcatcacagtgcaagcctctcctggcctggatcggaggagaaacgtgttcgaggtt
ggggctggggactcgcccaccttccctagattccgagccatccagttggaacctacagaa
tcaggccagacttggggtcgccagtcccccagacgtcttgaagattcaagcaatggagag
aggcgtgcttgctgggcctggggtcccagctcccccaagcctggggaggcccagaacggg
aggagacggtcccgcatggatgaagccacgtggtacctagattcagacgactcgtcccca
ttagggtcccctagtactcccccggcactcaacggtaatcctccaaggcctagccccgag
ccagaggagccacggagggccgggcccacggagcgaggcaatagctctgggacgcctaaa
ctgatccaacgtgcattgctacgggggaccgctctgctggcttccctaggccttggccga
gatctgcaacctccaggaggcctgagccgtgaacgcggggagtccccgacagcaccaccc
cctgcacagatgccctcaccctgcccacctgagctgccctccaccccgctcatccgcctc
tcacaaacaacacctgatgcccatagttcacccactcctggacccttattgctagaccta
ggtgttccctctggccagccatcagccaagagccctcgacgggaagagacacgtgggaga
accgtctcacccccaccaggaatatcacgctctgctcctggcacacctggaacccctcgc
tcaccaccgttgggcctaatcagccgacctcggccctcaccactccgtagccgtattgac
ccatggagcttcgtgtcagctgggccacggccttcacccctgccctctccacagcctgca
ccccgacgggcaccgtggaccttattcccagactcagatcccttctgggactccccacct
gccaaccccttccggggaggctcccaggactgcaggacgcagaccaaagacatgggtgcc
caggccccatgggcaccagaagcagggccctga

DBGET integrated database retrieval system