KEGG   Mus musculus (mouse): 26404Help
Entry
26404             CDS       T01002                                 

Gene name
Map3k12, DLK, MUK, Zpk
Definition
mitogen-activated protein kinase kinase kinase 12 (EC:2.7.11.25)
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mmu04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 F3; 15
AA seq 888 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTQCVLRDVVPLGGQGG
GGPSPSPGGEPPPEPFANSVLQLHEQDTGGPGGATGSPESRASRVRADEVRLQCQSGSGF
LEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGE
EVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRP
VTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTK
MSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSL
HLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWR
EEVKLHFEKIKSEGTCLHRLEEELVMRRREELRHALDIREHYERKLERANNLYMELNALM
LQLELKERELLRREQALERRCPGLLKSHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKRPD
ILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLPGLRAALP
PHEPGGLGSPGGLGVGPSAWDACPPALRGLHHDLLLRKMSSSSPDLLSAALGARGRGATG
GARDPGSPPPPQGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTAG
RGGNRAGSQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSEVELPPSQRWPQGPNMRQS
LSTFSSENPSDVEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDLPTSEV
VPEREASSLPMQHQDGQGPNPEDSDCDSTELDNSNSIDALRPPASLPP
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctccatgaaacccgaacaccctccccttcctttgggggctttgtgtctact
ctaagtgaggcttctatgcgaaagctggatccagacacttcagactgcacccccgagaaa
gacctgacgcccacccaatgtgtacttcgagatgttgtgcctctcggtgggcagggtgga
ggaggacccagcccctccccaggtggagagcctcccccagagccttttgccaatagtgtc
ctccagctacatgagcaggatacaggtgggccagggggagccactgggtcacctgagagt
cgagcatctagagttcgagctgatgaggtacgtctgcagtgccagagtggcagtggcttc
cttgaaggtctttttggctgcctgcgccctgtctggacaatgattggcaaagcctactcc
acagaacacaagcaacagcaggaagacctttgggaagtcccctttgaggaaatcctggac
ctgcagtgggtaggctcaggggctcagggtgctgttttcctgggacgcttccacggggag
gaggtagctgtgaagaaggttcgagatctcaaggagactgacatcaagcatcttcgaaag
ctgaagcaccccaacatcatcactttcaagggtgtttgcacacaggccccctgctactgc
atccttatggaattctgcgctcaaggacagctatatgaggtgctcagagccggccgccct
gtcaccccctccttgctggttgactggtccatgggcatcgctggtggcatgaattacctg
cacctgcacaagattatccacagagacctgaagtcacccaacatgctaatcacatacgac
gatgtggtgaagatctcagattttggcacttccaaggagctgagtgacaagagcaccaag
atgtcctttgcaggaacagtagcctggatggctcctgaagtgatcagaaatgaacctgtg
tctgagaaggttgacatctggtcctttggggtggtgctatgggaactactgactggagag
attccctacaaagatgtagattcctcagccatcatctggggtgtgggaagcaacagtctc
cacctgcctgtaccctccagctgcccagatggttttaaaattctacttcgccagtgctgg
aacagcaaaccacgaaatcgcccatcattccgacagatcttgctgcacctggacatcgcc
tccgctgatgtgctctctacaccccaggagacttactttaagtcccaggcagagtggcgg
gaagaagtaaaactgcactttgaaaagattaagtcagaagggacctgtctgcaccgccta
gaagaggaactggtgatgcggagaagggaggagctcagacatgccctggacatcagggag
cactatgaacggaagttggagagagccaacaacctgtacatggaactgaatgccctcatg
ctgcaactagaactcaaagagagggaattgctcaggcgagagcaggctttagaaaggcgg
tgtcctggtctactaaagtcacacccttctcggggcctcctacatggaaacactatggag
aagctcatcaagaaaaggaacgtgccacagaaactgtcgccccacagcaaaaggccagat
attctcaagacagagtcgttgctacctaaactagatgcagccctaagtggggtggggctt
cctgggtgtcctaagggccccccttcacctggaaggagtcggcgtggcaagacccgtcac
cgaaaggccagtgccaagggcagctgtggagacctgcctgggcttcgtgcagctttgcca
ccccatgagcctggaggactaggaagcccagggggcctaggagtgggcccttcagcttgg
gatgcttgcccccctgctctccgtggactccaccatgaccttctactccgaaagatgtca
tcatcatccccagacctgctatcagcagcgctgggagcccgaggccgaggggctacaggg
ggagctcgggatcctggctcaccacctccaccccagggcgatactcctccaagtgaggga
tcagctcctggttccaccagcccagattcgcctgggggagctaaaggggaaccccctcca
ccagtagggcctggagaaggtgtggggctgctgggaactggaagggaagggactgcaggc
cggggaggaaaccgggctgggtcccagcacttgacccccgctgcgctgctgtacagggct
gctgtgactcgaagtcagaaacgtggtatctcatctgaagaagaagaaggagaggtagac
agtgaagtagagctacccccaagtcaaaggtggcctcagggcccgaacatgcgtcagtca
ctatctacattcagctcagagaacccatcagatgtggaggaaggtacagctagtgagcct
tccccaagtggcacaccagaagttggcagtaccaacactgatgagcgaccagatgaacga
tctgatgacatgtgctcacagggctcagaaattccactggacctacctacttcagaggtg
gtccctgaacgtgaagccagctccttgcccatgcaacaccaggatggccagggccccaat
cctgaagactcagactgtgacagcactgaattggacaactccaacagcattgatgccttg
cggcccccagcctcccttcctccatga

DBGET integrated database retrieval system