KEGG   Mus musculus (mouse): 26404Help
Entry
26404             CDS       T01002                                 

Gene name
Map3k12, DLK, MUK, Zpk
Definition
mitogen-activated protein kinase kinase kinase 12 (EC:2.7.11.25)
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26404 (Map3k12)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26404 (Map3k12)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   26404 (Map3k12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 F3; 15
AA seq 888 aa AA seqDB search
MACLHETRTPSPSFGGFVSTLSEASMRKLDPDTSDCTPEKDLTPTQCVLRDVVPLGGQGG
GGPSPSPGGEPPPEPFANSVLQLHEQDTGGPGGATGSPESRASRVRADEVRLQCQSGSGF
LEGLFGCLRPVWTMIGKAYSTEHKQQQEDLWEVPFEEILDLQWVGSGAQGAVFLGRFHGE
EVAVKKVRDLKETDIKHLRKLKHPNIITFKGVCTQAPCYCILMEFCAQGQLYEVLRAGRP
VTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTSKELSDKSTK
MSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAIIWGVGSNSL
HLPVPSSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQETYFKSQAEWR
EEVKLHFEKIKSEGTCLHRLEEELVMRRREELRHALDIREHYERKLERANNLYMELNALM
LQLELKERELLRREQALERRCPGLLKSHPSRGLLHGNTMEKLIKKRNVPQKLSPHSKRPD
ILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDLPGLRAALP
PHEPGGLGSPGGLGVGPSAWDACPPALRGLHHDLLLRKMSSSSPDLLSAALGARGRGATG
GARDPGSPPPPQGDTPPSEGSAPGSTSPDSPGGAKGEPPPPVGPGEGVGLLGTGREGTAG
RGGNRAGSQHLTPAALLYRAAVTRSQKRGISSEEEEGEVDSEVELPPSQRWPQGPNMRQS
LSTFSSENPSDVEEGTASEPSPSGTPEVGSTNTDERPDERSDDMCSQGSEIPLDLPTSEV
VPEREASSLPMQHQDGQGPNPEDSDCDSTELDNSNSIDALRPPASLPP
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atggcctgcctccatgaaacccgaacaccctccccttcctttgggggctttgtgtctact
ctaagtgaggcttctatgcgaaagctggatccagacacttcagactgcacccccgagaaa
gacctgacgcccacccaatgtgtacttcgagatgttgtgcctctcggtgggcagggtgga
ggaggacccagcccctccccaggtggagagcctcccccagagccttttgccaatagtgtc
ctccagctacatgagcaggatacaggtgggccagggggagccactgggtcacctgagagt
cgagcatctagagttcgagctgatgaggtacgtctgcagtgccagagtggcagtggcttc
cttgaaggtctttttggctgcctgcgccctgtctggacaatgattggcaaagcctactcc
acagaacacaagcaacagcaggaagacctttgggaagtcccctttgaggaaatcctggac
ctgcagtgggtaggctcaggggctcagggtgctgttttcctgggacgcttccacggggag
gaggtagctgtgaagaaggttcgagatctcaaggagactgacatcaagcatcttcgaaag
ctgaagcaccccaacatcatcactttcaagggtgtttgcacacaggccccctgctactgc
atccttatggaattctgcgctcaaggacagctatatgaggtgctcagagccggccgccct
gtcaccccctccttgctggttgactggtccatgggcatcgctggtggcatgaattacctg
cacctgcacaagattatccacagagacctgaagtcacccaacatgctaatcacatacgac
gatgtggtgaagatctcagattttggcacttccaaggagctgagtgacaagagcaccaag
atgtcctttgcaggaacagtagcctggatggctcctgaagtgatcagaaatgaacctgtg
tctgagaaggttgacatctggtcctttggggtggtgctatgggaactactgactggagag
attccctacaaagatgtagattcctcagccatcatctggggtgtgggaagcaacagtctc
cacctgcctgtaccctccagctgcccagatggttttaaaattctacttcgccagtgctgg
aacagcaaaccacgaaatcgcccatcattccgacagatcttgctgcacctggacatcgcc
tccgctgatgtgctctctacaccccaggagacttactttaagtcccaggcagagtggcgg
gaagaagtaaaactgcactttgaaaagattaagtcagaagggacctgtctgcaccgccta
gaagaggaactggtgatgcggagaagggaggagctcagacatgccctggacatcagggag
cactatgaacggaagttggagagagccaacaacctgtacatggaactgaatgccctcatg
ctgcaactagaactcaaagagagggaattgctcaggcgagagcaggctttagaaaggcgg
tgtcctggtctactaaagtcacacccttctcggggcctcctacatggaaacactatggag
aagctcatcaagaaaaggaacgtgccacagaaactgtcgccccacagcaaaaggccagat
attctcaagacagagtcgttgctacctaaactagatgcagccctaagtggggtggggctt
cctgggtgtcctaagggccccccttcacctggaaggagtcggcgtggcaagacccgtcac
cgaaaggccagtgccaagggcagctgtggagacctgcctgggcttcgtgcagctttgcca
ccccatgagcctggaggactaggaagcccagggggcctaggagtgggcccttcagcttgg
gatgcttgcccccctgctctccgtggactccaccatgaccttctactccgaaagatgtca
tcatcatccccagacctgctatcagcagcgctgggagcccgaggccgaggggctacaggg
ggagctcgggatcctggctcaccacctccaccccagggcgatactcctccaagtgaggga
tcagctcctggttccaccagcccagattcgcctgggggagctaaaggggaaccccctcca
ccagtagggcctggagaaggtgtggggctgctgggaactggaagggaagggactgcaggc
cggggaggaaaccgggctgggtcccagcacttgacccccgctgcgctgctgtacagggct
gctgtgactcgaagtcagaaacgtggtatctcatctgaagaagaagaaggagaggtagac
agtgaagtagagctacccccaagtcaaaggtggcctcagggcccgaacatgcgtcagtca
ctatctacattcagctcagagaacccatcagatgtggaggaaggtacagctagtgagcct
tccccaagtggcacaccagaagttggcagtaccaacactgatgagcgaccagatgaacga
tctgatgacatgtgctcacagggctcagaaattccactggacctacctacttcagaggtg
gtccctgaacgtgaagccagctccttgcccatgcaacaccaggatggccagggccccaat
cctgaagactcagactgtgacagcactgaattggacaactccaacagcattgatgccttg
cggcccccagcctcccttcctccatga

DBGET integrated database retrieval system