KEGG   Mus musculus (mouse): 26406Help
Entry
26406             CDS       T01002                                 

Gene name
Map3k3, AW548911, MAPKKK3, Mekk3, mKIAA4031
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 3 (EC:2.7.11.25)
  KO
K04421  
mitogen-activated protein kinase kinase kinase 3 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Neurotrophin signaling pathway
GnRH signaling pathway
HTLV-I infection
Module
MAPK (JNK) signaling
MAPK (p38) signaling
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26406 (Map3k3)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    26406 (Map3k3)
  Nervous system
   04722 Neurotrophin signaling pathway
    26406 (Map3k3)
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    26406 (Map3k3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26406 (Map3k3)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   26406 (Map3k3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E1
AA seq 626 aa AA seqDB search
MDEQEALDSIMKDLVALQMSRRTRLSGYETMKNKDTGHPNRQSDVRIKFEHNGERRIIAF
SRPVRYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHTSSSPHSGVSRQVRIKPSQSAGDINTIYQAPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSQMSRARSFPDNRKECSDRETQLYDKGVKGGTYPRRYHVSVHHKDYNDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGVAVQYLDPRGRLRSADSENALTVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKILTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGIRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLVY
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggatgaacaagaggcattagactcgatcatgaaggacctggtggccctccagatgagc
cgacgaacccggttgtctggatatgagaccatgaagaataaggacacaggtcacccaaac
aggcagagtgacgtcagaatcaagtttgaacacaatggggagagacgaattatagcattc
agccggcctgtgagatacgaagatgtggagcacaaggtgacaacagtctttgggcagcct
cttgatttgcattatatgaataatgagctctccatcctgttgaaaaaccaagatgatctc
gataaagccattgacattttggatagaagctcaagtatgaaaagccttaggatactactg
ttatcccaagacagaaaccatactagttcctctccccactctggagtgtccaggcaggtt
cggatcaagccttcccagtctgcaggggatataaataccatctaccaagctcctgagccc
agaagcaggcacctgtctgtcagctcccagaaccctggccgaagctctcctcccccggga
tatgtacctgagcgacaacagcacattgcccggcaaggatcctatacgagcatcaacagc
gaaggtgaattcatcccagagaccagcgaacagtgtatgctagatcccctcagcagtgcc
gaaaattccttgtcaggaagctgccaatccttggacaggtcagcagacagcccatccttc
aggaaatcacaaatgtcccgagcccggagcttcccagacaacagaaaggaatgctcagat
cgggagacccagctctatgataaaggtgtcaaaggtggaacctatcccaggcgctaccat
gtgtctgtgcatcacaaagactacaatgatggcagaagaacatttccccgaatacgacgg
catcaaggcaacctattcactctggtgccctcaagtcgctccttgagcacaaatggcgag
aacatgggtgtagctgtgcaatacctggacccccgtgggcgcctacggagtgcagacagt
gagaatgccctcactgtgcaggaaaggaatgtgccaaccaaatctcctagtgctcccatc
aattggcgtcgggggaagctcctgggtcaaggtgccttcggcagggtctacttgtgctat
gatgtggacacaggacgtgaacttgcttctaagcaggtccagtttgacccagatagtcct
gagacaagcaaggaggtgagtgctctggagtgtgagatccagttgctgaagaacctgcag
catgagcgcattgtgcagtactacggctgcctgcgggaccgtgctgagaagatcctcacc
atctttatggagtatatgccagggggctctgtaaaagaccagttgaaggcctacggagct
ctgacagagagtgtgacccgcaagtacacccggcagattctggagggcatgtcatacctg
cacagcaacatgattgtgcatcgggacatcaagggagccaatatcctccgagactcagct
gggaatgtgaagcttggggattttggggccagcaaacgcctacagaccatctgcatgtca
gggacaggcattcgctctgtcactggcacaccctactggatgagtcctgaagtcatcagt
ggcgagggctatggaagaaaggcagacgtgtggagcctgggctgtactgtggtggaaatg
ctgacagagaaaccaccttgggcagagtatgaagctatggctgccattttcaagattgcc
acccagcctaccaatcctcagctgccctctcacatctcagaacacggcagggacttcctg
aggcgcatatttgtggaagctcgtcagagaccctcagctgaggagctgctcacacaccac
tttgcacagctagtgtactga

DBGET integrated database retrieval system