KEGG   Mus musculus (mouse): 26407Help
Entry
26407             CDS       T01002                                 

Gene name
Map3k4, D17Rp17, D17Rp17e, MAPKKK4, MEKK_4, MTK1, Mek4b, Mekk4, RP17, Rp17a, Tas, mKIAA0213
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 4 (EC:2.7.11.25)
  KO
K04428  
mitogen-activated protein kinase kinase kinase 4 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
GnRH signaling pathway
Module
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26407 (Map3k4)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    26407 (Map3k4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26407 (Map3k4)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: STE group
  STE11 family
   26407 (Map3k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 8.42 cM; 17 A1
AA seq 1597 aa AA seqDB search
MRDAIAEPVPPPALADTPAAAMEELRPAPPPQPEPDPECCPAARQECMLGESARKSMESD
PEDFSDETNTETLYGTSPPSTPRQMKRLSAKHQRNSAGRPASRSNLKEKMNTPSQSPHKD
LGKGVETVEEYSYKQEKKIRATLRTTERDHKKNAQCSFMLDSVAGSLPKKSIPDVDLNKP
YLSLGCSNAKLPVSMPMPIARTARQTSRTDCPADRLKFFETLRLLLKLTSVSKKKDREQR
GQENTAAFWFNRSNELIWLELQAWHAGRTINDQDLFLYTARQAIPDIINEILTFKVNYGS
IAFSSNGAGFNGPLVEGQCRTPQETNRVGCSSYHEHLQRQRVSFEQVKRIMELLEYMEAL
YPSLQALQKDYERYAAKDFEDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLSDIGWPVF
EIPSPRPSKGYEPEDEVEDTEVELRELESGTEESDEEPTPSPRVPELRLSTDAILDSRSQ
GCVSRKLERLESEEDSIGWGTADCGPEASRHCLTSIYRPFVDKALKQMGLRKLILRLHKL
MNGSLQRARVALVKDDRPVEFSDFPGPMWGSDYVQLSGTPPSSEQKCSAVSWEELRAMDL
PSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLKGGLLMKQYY
QFMLQEVLGGLEKTDCNMDAFEEDLQKMLMVYFDYMRSWIQMLQQLPQASHSLKNLLEEE
WNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLESGLQESCAELWTSADDNGAADE
LRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFVLSASARELLDALKAKQ
YVKVQIPGLENLHVFVPDSLAEEKKIILQLLNAATGKDCSKDPDDVFMDAFLLLTKHGDR
ARDSEDGWGTWEARAVKIVPQVETVDTLRSMQVDNLLLVVMESAHLVLQRKAFQQSIEGL
MTVRHEQTSSQPIIAKGLQQLKNDALELCNRISDAIDRVDHMFTLEFDAEVEESESATLQ
QYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFAQKWMNYVLTKCESGRGTRP
RWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTAIHRNSPRPVK
VPRCHSDPPNPHLIIPTPEGFSTRSVPSDARTHGNSVAAAAAVAAAATTAAGRPGPGGGD
SVPAKPVNTAPDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPAYPRSDSSGST
RRSWELRTLISQTKDSASKQGPIEAIQKSVRLFEERRYREMRRKNIIGQVCDTPKSYDNV
MHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADEL
KIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVIRLYTKQITVAI
NVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVNSTLGTAAYMAP
EVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGMGHKPPIPERLS
PEGKAFLSHCLESDPKIRWTASQLLDHAFVKVCTDEE
NT seq 4794 nt NT seq  +upstreamnt  +downstreamnt
atgagagacgccatcgccgagccggtgccccctcctgccctcgccgacacccctgcagcc
gccatggaggagctgcggccagcaccgccgccacagcccgagccggatccggagtgctgc
ccagcggcgaggcaggagtgcatgttgggagagtcggctcgcaaaagtatggaatccgat
ccagaggacttttctgatgaaacaaatacagagactctctacggcacctcacccccaagc
acacctcgacagatgaaacgcctgtcagccaagcaccagaggaacagcgcagggaggccg
gccagccgatcgaacttgaaagaaaaaatgaacacaccgagtcagtctccacataaagat
ttggggaagggagtggagaccgtggaagaatacagctacaagcaggagaagaagattcga
gcaactctgagaacaacggagcgagaccataagaaaaatgcacagtgctcgttcatgttg
gactcggtggctgggtctttgccaaaaaaatcgattccagatgtggatctcaataagcct
tacctcagtctcggctgtagcaatgccaagctgcccgtctcgatgcccatgccgatagcc
agaactgcacggcagacttcccggactgactgccccgcagatcgcttaaagttctttgaa
acactgcgccttttgctaaagcttacctcagtctcgaagaagaaggacagggagcagagg
ggacaagaaaacacggctgctttctggttcaaccgatcgaacgaactgatctggttagaa
ctgcaggcctggcacgcgggccgcaccatcaatgaccaggacctctttctctacacagcc
cgccaggccatcccagacatcatcaatgagatcctcaccttcaaagttaactacgggagc
attgccttctccagcaatggagccggtttcaacgggcccttggtagaaggccagtgcaga
acccctcaggagacaaaccgtgtgggctgctcatcgtaccacgagcacctccagcgccag
agggtctcgtttgagcaggtgaagcggataatggagctgctggagtacatggaggcactt
tacccatccttgcaggctctgcagaaggactatgaacggtacgccgccaaggactttgag
gacagagtgcaggcgctctgcctgtggctcaacatcacgaaagatctaaatcagaagctg
cggatcatgggcaccgtgctgggcatcaagaacctatcagacattggctggccagtgttt
gaaatcccctcccctcggccgtccaagggctacgagccagaggacgaggtcgaggacacg
gaggttgagctgagggagctggagagcgggacggaggagagtgacgaggagccaaccccc
agtccgagggtgccagagctcaggctgtccacagacgccatcttggacagtcgctcccag
ggctgcgtctccaggaagctggagaggctcgagtcagaggaagattccataggctggggg
acagcggactgtggccctgaagccagcaggcattgtttgacttctatctatagaccattc
gtggacaaagcactgaagcaaatggggctaagaaagttaattttacgacttcataagctt
atgaatgggtccttgcaaagagctcgtgtagctctggtgaaggacgaccgtccagtggag
ttctctgactttccaggtcccatgtggggctcggattatgtgcagttgtcgggaacacct
ccttcctcagagcagaagtgtagcgctgtgtcctgggaagaactgagagccatggacctg
ccttcctttgagcccgccttcctggtgctctgtcgggtcctgctgaacgtgatccacgag
tgcctgaagctgcggctggaacagaggcctgccggggagccttccctcttgagtatcaaa
cagctagtgcgagagtgtaaagaggtcctaaagggcgggctcctgatgaagcagtattac
cagttcatgctgcaggaggtcctgggcggactggagaagaccgactgcaacatggatgcc
tttgaggaggacctgcagaagatgctgatggtgtattttgattacatgagaagctggatc
caaatgctacagcagttacctcaggcttcccatagcttaaaaaacctgctagaagaggaa
tggaatttcaccaaagaaataacccattatatccgtggcggagaagcgcaggctggaaag
cttttctgtgacatcgcagggatgctgctgaaatccacagggagctttctggaatccggc
ctgcaggagagctgtgctgagctgtggaccagcgccgacgacaacggtgctgccgacgag
ctaaggagatctgtcatcgagatcagccgagcactcaaggagctcttccacgaagccagg
gaaagagcctccaaggccctgggctttgctaaaatgctgaggaaggacctagaaatagca
gcagagttcgtgctatctgcatcagcccgagagctcctggacgctctgaaagcaaagcag
tatgttaaggtacagattcccgggttagagaatttgcacgtgtttgtccccgacagcctc
gctgaggagaagaaaattattttgcagctactcaatgctgccacaggaaaggactgctca
aaggatccagacgacgtcttcatggatgccttcctgctcctgaccaagcatggggaccga
gcccgtgactcagaagatggctggggcacatgggaagctcgggctgtcaaaattgtgcct
caggtggagactgtggacaccctgagaagcatgcaggtggacaaccttctgctggttgtc
atggagtctgctcacctcgtacttcagagaaaagccttccagcagtccattgaggggctg
atgactgtacgccatgagcagacatctagccagcccatcatcgccaaaggtttgcagcag
ctcaagaacgatgcacttgagctatgcaacagaatcagcgatgccatcgaccgtgtggac
cacatgttcaccctggagttcgatgctgaggtcgaggagtctgagtcggccacgctgcag
cagtactaccgagaagccatgattcagggctacaactttgggtttgagtatcataaagaa
gttgttcgtttgatgtctggggaattcaggcagaagataggagacaaatatataagcttc
gcccagaagtggatgaattacgtgctgaccaaatgcgagagcggcagaggcacaagaccc
agatgggccacccaaggatttgatttcctacaagccattgaacctgcctttatttcagct
ttaccagaagatgacttcttgagtttgcaagccctgatgaatgagtgcatcgggcacgtc
ataggaaagccacacagccctgtcacagctatccatcggaacagcccccgccctgtgaag
gtgccccgatgccacagtgaccctcctaaccctcacctcatcatcccgactccagaggga
ttcagcacccggagcgtgccttccgacgctcggacccatggcaactctgttgctgctgct
gctgctgttgctgccgccgccaccactgctgctggccgccctggcccaggtggtggtgac
tctgtgccagccaaacctgtcaacactgcccctgataccaggggttccagtgtccctgaa
aacgaccgcttggcctccatagctgcagaactgcagttcaggtctctgagtcggcactca
agccccacggaagagcgagacgagccagcgtatcctcggagtgactcaagtggatcaact
cggagaagctgggaacttcgaacactcatcagccagaccaaagactcggcctctaagcag
gggcccatagaagctatccagaagtcagtccgactgtttgaagagaggaggtatcgagag
atgaggagaaagaatatcatcggccaagtgtgcgatacccctaagtcctatgataacgtc
atgcatgttggactgaggaaggtgacatttaagtggcaaagaggaaacaaaattggagaa
ggacagtatggaaaagtatacacctgcatcagtgttgacacaggggagctgatggccatg
aaggagattcgatttcagcctaacgaccacaagactatcaaggagactgcagacgagttg
aaaatatttgaaggcatcaagcaccccaacctggtccggtattttggcgtggagcttcac
agggaagagatgtacatcttcatggagtactgtgatgagggtacactagaggaggtgtca
cgactgggcctgcaggagcacgtcatcaggttatataccaagcagatcactgtcgccatc
aacgtcctccatgagcacggcatcgttcaccgagacatcaaaggtgccaatatcttcctt
acgtcatctggactaatcaagctgggagattttggatgctctgtaaaacttaaaaacaac
gcccagaccatgcccggagaggtgaacagcaccctagggacagcagcttacatggcccct
gaagttattacccgagccaaaggagaaggccacggacgtgcggcagatatctggagtctg
gggtgcgtcgtcatagagatggtgactggcaagcggccttggcatgagtatgaacacaac
tttcagattatgtacaaggtggggatgggacacaagccaccaatcccggaaaggctaagc
cctgaaggaaaggcctttctctcgcactgcctggaaagtgacccgaagatacggtggaca
gccagccagctcctcgaccacgcttttgtcaaggtttgcacagatgaagagtga

DBGET integrated database retrieval system