KEGG   Mus musculus (mouse): 26409Help
Entry
26409             CDS       T01002                                 

Gene name
Map3k7, B430101B05, C87327, Tak1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7 (EC:2.7.11.25)
  KO
K04427  
mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
AMPK signaling pathway
Wnt signaling pathway
Osteoclast differentiation
Adherens junction
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
T cell receptor signaling pathway
TNF signaling pathway
Leishmaniasis
Toxoplasmosis
Measles
Herpes simplex infection
Epstein-Barr virus infection
Module
Toll-like receptor signaling
MAPK (JNK) signaling
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    26409 (Map3k7)
   04310 Wnt signaling pathway
    26409 (Map3k7)
   04064 NF-kappa B signaling pathway
    26409 (Map3k7)
   04668 TNF signaling pathway
    26409 (Map3k7)
   04152 AMPK signaling pathway
    26409 (Map3k7)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    26409 (Map3k7)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    26409 (Map3k7)
   04621 NOD-like receptor signaling pathway
    26409 (Map3k7)
   04622 RIG-I-like receptor signaling pathway
    26409 (Map3k7)
   04660 T cell receptor signaling pathway
    26409 (Map3k7)
  Development
   04380 Osteoclast differentiation
    26409 (Map3k7)
 Human Diseases
  Infectious diseases
   05162 Measles
    26409 (Map3k7)
   05168 Herpes simplex infection
    26409 (Map3k7)
   05169 Epstein-Barr virus infection
    26409 (Map3k7)
   05145 Toxoplasmosis
    26409 (Map3k7)
   05140 Leishmaniasis
    26409 (Map3k7)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     26409 (Map3k7)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   26409 (Map3k7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 A5
AA seq 579 aa AA seqDB search
MSTASAASSSSSSSASEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIVATAGNGQPRRRSIQDLTVTG
TEPGQVSSRSSSPSVRMITTSGPTSEKPARSHPWTPDDSTDTNGSDNSIPMAYLTLDHQL
QPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEIALLLQRKQELVAELDQDEKDQQNTSRL
VQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQKRQGTS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacagcctccgccgcctcgtcctcctcctcgtcttctgccagtgagatgatcgaa
gcgccgtcgcaggtcctgaacttcgaagagatcgactacaaggagatcgaggtggaagag
gttgtcggaagaggagcttttggagtagtttgcaaagctaagtggagagcaaaagatgtc
gctattaaacagatagaaagtgagtctgagaggaaggctttcattgtggagctccggcag
ttgtcacgtgtgaaccatcctaacattgtcaagttgtatggagcctgcctgaatccagta
tgtcttgtgatggaatatgcagaggggggctcattgtataatgtgctgcatggtgctgaa
ccattgccttactacactgctgctcatgccatgagctggtgtttacagtgttcccaagga
gtggcttacctgcacagcatgcagcccaaagcgctgattcacagggacctcaagcctcca
aacttgctgctggttgcaggagggacagttctaaaaatctgcgattttggtacagcttgt
gacatccaaacacacatgaccaataataaagggagtgctgcttggatggcgcctgaagta
tttgaaggtagcaattacagtgaaaagtgtgatgtcttcagctggggtattatcctctgg
gaagtgataacacgccggaaacccttcgatgagatcggtggcccagctttcagaatcatg
tgggctgttcataatggcactcgaccaccactgatcaaaaatttacctaagcccattgag
agcttgatgacacgctgttggtctaaggacccatctcagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtacttcccaggagcggatgagccgttacagtat
ccttgtcagtactctgatgaagggcagagcaactcagccaccagcacaggctcattcatg
gacattgcttctacaaataccagtaataaaagtgacacaaatatggaacaggttcctgcc
acaaacgacactattaaacgcttggagtcaaaacttttgaaaaaccaggcaaagcaacag
agtgaatctggacgcctgagcttgggagcctctcgtgggagcagtgtggagagcttgccc
cccacttccgagggcaagaggatgagtgctgacatgtctgaaatagaagccaggatcgtg
gcgactgcaggtaacgggcaaccaaggcgtagatccatccaagacttgactgttactggg
acagaacctggtcaggtgagcagccggtcatccagccctagtgtcagaatgatcactacc
tcaggaccaacctcagagaagccagctcgcagtcacccgtggacccctgatgattccaca
gataccaatggctcagataactccatcccaatggcgtatcttacactggatcaccagcta
cagcctctagcgccgtgcccaaactccaaagaatccatggcagtgttcgaacaacattgt
aaaatggcacaggagtatatgaaagttcaaaccgaaatcgcattgttactacagagaaag
caagaactagttgcagaattggaccaggatgaaaaggaccagcaaaatacatctcgtctg
gtacaggaacataaaaagcttttagatgaaaacaaaagcctttctacttattaccagcaa
tgcaaaaaacaactagaggtcatcagaagccaacagcagaaacgacaaggcacttcatga

DBGET integrated database retrieval system