KEGG   Mus musculus (mouse): 26556Help
Entry
26556             CDS       T01002                                 

Gene name
Homer1, PSD-Zip45, SYN47, Ves-1, homer-1, vesl-1
Definition
homer homolog 1 (Drosophila)
Orthology
K15010  
homer
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Glutamatergic synapse
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mmu04068]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:mmu04724]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
13 C3; 13
AA seq 354 aa AA seqDB search
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFPHSSAIS
KHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKRVTELECVSSQAN
AVHSHKTELNQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLTQKLQEVEIRNKD
LEGQLSDLEQRLEKSQNEQEAFRSNLKTLLEILDGKIFELTELRDNLAKLLECS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcaacctatcttcagcactcgagctcatgtcttccagattgacccgaacaca
aagaagaactgggtacccaccagcaagcatgcagttactgtatcttatttttatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagcacc
atcacaccaaacatgacatttactaaaacatctcaaaagtttggccaatgggctgatagc
cgggcaaacactgtttatggactgggattctcctctgagcatcatctttcaaaattcgca
gaaaagtttcaggaatttaaggaagctgctcggcttgcaaaggagaagtcgcaggagaag
atggagctgaccagtaccccttcacaggaatcagcaggaggagatcttcagtctcctttg
acaccagaaagtatcaatgggacagacgatgagagaacacccgatgtgacacagaactca
gagccaagggctgagccaactcagaatgcattgccatttccacatagttcagcaatcagc
aaacactgggaggctgagctagctaccctcaaaggcaacaatgccaaactcactgcagcc
ctgctggagtccactgccaatgtgaagcagtggaagcaacagcttgctgcgtaccaggag
gaagcagagcggctgcacaagcgggtcactgagctggagtgtgttagtagtcaagcaaac
gctgtgcacagccacaagacagagctgaaccagacagtgcaggaactggaagagaccctg
aaagtaaaggaagaggaaatagaaagattaaaacaagaaatcgataatgccagagaactc
caagaacagagggactctttgactcagaaactacaggaagttgaaattcgaaataaagac
ctggaggggcagctgtctgacctagaacagcgcctggagaagagccagaacgaacaagag
gctttccgcagtaacctgaagacactcctagaaattctggatggaaaaatatttgaacta
acagaattacgagataatttggccaagctactggaatgcagctaa

DBGET integrated database retrieval system