KEGG   Mus musculus (mouse): 26556Help
Entry
26556             CDS       T01002                                 

Gene name
Homer1, PSD-Zip45, SYN47, Ves-1, homer-1, vesl-1
Definition
(RefSeq) homer scaffolding protein 1
  KO
K15010  
homer
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    26556 (Homer1)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    26556 (Homer1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13; 13 C3
AA seq 366 aa AA seqDB search
MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINST
ITPNMTFTKTSQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEK
MELTSTPSQESAGGDLQSPLTPESINGTDDERTPDVTQNSEPRAEPTQNALPFPHSAGDR
TQALSHASSAISKHWEAELATLKGNNAKLTAALLESTANVKQWKQQLAAYQEEAERLHKR
VTELECVSSQANAVHSHKTELNQTVQELEETLKVKEEEIERLKQEIDNARELQEQRDSLT
QKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRSNLKTLLEILDGKIFELTELRDNLA
KLLECS
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgggggagcaacctatcttcagcactcgagctcatgtcttccagattgacccgaacaca
aagaagaactgggtacccaccagcaagcatgcagttactgtatcttatttttatgacagc
acaagaaatgtgtataggataatcagtttagatggctcaaaggcaataataaatagcacc
atcacaccaaacatgacatttactaaaacatctcaaaagtttggccaatgggctgatagc
cgggcaaacactgtttatggactgggattctcctctgagcatcatctttcaaaattcgca
gaaaagtttcaggaatttaaggaagctgctcggcttgcaaaggagaagtcgcaggagaag
atggagctgaccagtaccccttcacaggaatcagcaggaggagatcttcagtctcctttg
acaccagaaagtatcaatgggacagacgatgagagaacacccgatgtgacacagaactca
gagccaagggctgagccaactcagaatgcattgccatttccacatagtgctggggatcga
acccaggccctctctcatgctagttcagcaatcagcaaacactgggaggctgagctagct
accctcaaaggcaacaatgccaaactcactgcagccctgctggagtccactgccaatgtg
aagcagtggaagcaacagcttgctgcgtaccaggaggaagcagagcggctgcacaagcgg
gtcactgagctggagtgtgttagtagtcaagcaaacgctgtgcacagccacaagacagag
ctgaaccagacagtgcaggaactggaagagaccctgaaagtaaaggaagaggaaatagaa
agattaaaacaagaaatcgataatgccagagaactccaagaacagagggactctttgact
cagaaactacaggaagttgaaattcgaaataaagacctggaggggcagctgtctgaccta
gaacagcgcctggagaagagccagaacgaacaagaggctttccgcagtaacctgaagaca
ctcctagaaattctggatggaaaaatatttgaactaacagaattacgagataatttggcc
aagctactggaatgcagctaa

DBGET integrated database retrieval system