KEGG   Mus musculus (mouse): 268756Help
Entry
268756            CDS       T01002                                 

Gene name
Gulo, 5730581M22, AU018375, BC028822, sfx, unh, unhip
Definition
gulonolactone (L-) oxidase (EC:1.1.3.8)
Orthology
K00103  
L-gulonolactone oxidase [EC:1.1.3.8]
Organism
mmu  Mus musculus (mouse)
Pathway
Ascorbate and aldarate metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    268756 (Gulo)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.8  L-gulonolactone oxidase
     268756 (Gulo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 D1; 14
AA seq 440 aa AA seqDB search
MVHGYKGVQFQNWAKTYGCSPEMYYQPTSVGEVREVLALARQQNKKVKVVGGGHSPSDIA
CTDGFMIHMGKMNRVLQVDKEKKQVTVEAGILLTDLHPQLDKHGLALSNLGAVSDVTVGG
VIGSGTHNTGIKHGILATQVVALTLMKADGTVLECSESSNADVFQAARVHLGCLGVILTV
TLQCVPQFHLLETSFPSTLKEVLDNLDSHLKKSEYFRFLWFPHSENVSIIYQDHTNKEPS
SASNWFWDYAIGFYLLEFLLWTSTYLPRLVGWINRFFFWLLFNCKKESSNLSHKIFSYEC
RFKQHVQDWAIPREKTKEALLELKAMLEAHPKVVAHYPVEVRFTRGDDILLSPCFQRDSC
YMNIIMYRPYGKDVPRLDYWLAYETIMKKFGGRPHWAKAHNCTRKDFEKMYPAFHKFCDI
REKLDPTGMFLNSYLEKVFY
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtccatgggtacaaaggggtccagttccaaaactgggcgaagacctatggctgcagt
ccagagatgtactaccagcccacatcagtgggggaggtcagagaggtgctggccctggcc
cggcagcagaacaagaaagtgaaggtggtgggtggcggccactcgccttcagacatcgcc
tgcaccgatggcttcatgattcacatgggcaagatgaaccgggttctccaggtggacaag
gagaagaagcaggtcacagtggaagccggtatcctcctgactgacctgcacccacagctg
gacaagcatggcctggccctgtctaatctgggagccgtgtctgatgtgacggttggtggc
gtcattgggtctggaacacataacaccgggatcaagcacggtatcctggccacccaggtg
gtggccctgaccctgatgaaggctgatggaacagttctggaatgttctgagtcaagtaat
gcagatgtgttccaggctgcaagggtgcacctgggctgcctgggtgttatcctcactgtc
accctgcagtgtgtgccacagttccaccttctggagacatcctttccttcgaccctcaag
gaggtccttgacaacctggacagccacctgaagaagtctgagtacttccgcttcctctgg
tttcctcacagtgagaacgtcagcatcatctaccaagatcacaccaacaaggagccctcc
tctgcatctaactggttttgggactatgccattgggttctacctcctggaattcttgctc
tggaccagcacctacctgccacgcctcgtgggctggatcaaccgcttcttcttctggctg
ctgttcaactgcaagaaggagagcagcaacctcagccacaagatcttctcctacgagtgt
cgcttcaagcagcatgtccaagactgggccatccccagggagaagaccaaggaggccctg
ctggagctaaaggccatgctggaggcccaccccaaggtggtagcccactaccccgtggag
gtgcgcttcacccgaggtgatgacatcctgctgagcccgtgcttccagagggacagctgc
tacatgaacatcattatgtacaggccctatgggaaggatgtgcctcggttggattactgg
ctggcctatgagaccatcatgaagaagtttggaggcaggccccactgggcaaaggcccac
aattgcaccaggaaggactttgagaaaatgtaccccgcctttcacaagttctgtgacatc
cgcgagaagctggaccccactggaatgttcttgaattcgtacctggaaaaggttttctac
taa

DBGET integrated database retrieval system