KEGG   Mus musculus (mouse): 269019Help
Entry
269019            CDS       T01002                                 

Gene name
Stk32a, A930015B13Rik, YANK1
Definition
(RefSeq) serine/threonine kinase 32A (EC:2.7.11.1)
  KO
K08793  
serine/threonine kinase 32 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     269019 (Stk32a)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  YANK family
   269019 (Stk32a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 B3
AA seq 398 aa AA seqDB search
MGANTSSKAPVFDENEDVNFDHFEILRAIGKGSFGKVCIVRKNDTKKMYAMKYMNKQKCV
ERNEVRNVFKELQIMQGLEHPFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVHFQE
DTVKLFICELAMALDYLQSQRIIHRDMKPDNILLDEHGHVHITDFNIAAMLPKETRITTV
AGTKPYMAPEMFTSRKETGYSFAVDWWSLGVTAYELLRGRRPYHIRSSTSSKEIVNMFET
AIVTYPSAWSQEMVSLLKKLLEPNPDQRFSHLTDIQNFPYMSDMNWDAVLQKRLIPGFIP
TKGRLNCDPTFELEEMILESKPLHKKKKRLAKREKEMKKSDSSQTCLLQEHLDAVQKEFI
IFNREKVKSDFNQRQANLALEQTKNNTEEEEDGQNNNL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgggagccaacacttcaagcaaagccccagtgtttgatgaaaatgaagacgtcaacttt
gaccactttgaaattttgcgagccattgggaagggaagttttgggaaggtctgcattgtg
cggaagaatgacaccaagaagatgtacgccatgaagtacatgaacaaacagaagtgtgtg
gagcggaatgaagtgaggaatgtcttcaaggaactccagatcatgcagggcctggagcac
cctttcctggtgaatctgtggtattccttccaagatgaggaggacatgttcatggtggtg
gacctgctactcggtggtgacctgcgttatcacctgcagcagaatgtccacttccaggag
gacacagtgaagctcttcatctgtgagctggccatggccctggactacctacagagccag
cgcatcattcacagggatatgaaacctgacaatattttacttgatgaacatgggcatgtg
cacatcacagacttcaacattgctgccatgctgcccaaggagacccggatcaccaccgta
gctggcaccaagccttacatggcaccggagatgttcacgtctaggaaggaaacaggctac
tcctttgctgtcgactggtggtccctcggggtgacggcttacgaactgctgagaggccgg
agaccatatcacatccgctccagtacttccagcaaggaaattgtgaacatgtttgagaca
gcaattgtaacttacccttctgcctggtcacaggagatggtatcccttcttaaaaagctg
cttgaacctaatccagaccaacgcttttctcacttgactgacattcagaatttcccttac
atgagtgacatgaactgggacgccgtcctgcagaagaggctcattccaggcttcattccg
accaaaggcaggctcaattgtgaccccacttttgaactggaagaaatgattttggagtcc
aaacctcttcacaagaaaaagaaacgactggctaaaagggagaaggaaatgaagaaaagt
gactcctctcagacgtgccttcttcaagagcatcttgatgctgttcagaaagaatttata
attttcaacagagaaaaagtaaaaagtgactttaatcagagacaagcaaatctagccttg
gaacaaaccaaaaacaacacagaagaggaggaggacggccagaataacaacctataa

DBGET integrated database retrieval system